DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl62A and CG10822

DIOPT Version :9

Sequence 1:NP_001261256.1 Gene:robl62A / 38170 FlyBaseID:FBgn0028567 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_611450.1 Gene:CG10822 / 37274 FlyBaseID:FBgn0034478 Length:114 Species:Drosophila melanogaster


Alignment Length:81 Identity:24/81 - (29%)
Similarity:39/81 - (48%) Gaps:9/81 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VSENAG--DSLL--HTSFDLTTAQSIVKHLHASFL--KLAQSC---VRDLDTDDKLCFLRVKTRK 87
            |.|..|  |.|:  |:...:.|:....:.|..:.|  .|.:.|   :..::....|..|||:|:.
  Fly    22 VQEKPGVEDILIMNHSGVPVKTSMDRQEGLQYACLYDNLREKCQAFLSKMEPAQNLTLLRVRTKY 86

  Fly    88 HEFLVSPEEAFTVTVV 103
            ||.|::|:...||.||
  Fly    87 HEVLITPDAKITVLVV 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robl62ANP_001261256.1 Robl_LC7 24..103 CDD:214939 22/79 (28%)
CG10822NP_611450.1 Robl_LC7 15..102 CDD:214939 22/79 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4115
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2020
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10779
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.