DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl62A and Dynlrb2

DIOPT Version :9

Sequence 1:NP_001261256.1 Gene:robl62A / 38170 FlyBaseID:FBgn0028567 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_001101921.1 Gene:Dynlrb2 / 361415 RGDID:1306930 Length:96 Species:Rattus norvegicus


Alignment Length:69 Identity:24/69 - (34%)
Similarity:42/69 - (60%) Gaps:1/69 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NAGDSLLHTSFDLTTAQSIVKHLHASFLKLAQSCVRDLDTDDKLCFLRVKTRKHEFLVSPEEAFT 99
            ||....:.|:.|.:|.......||...:| |:|.|||:|..:.|.|||::::|||.:|:|::.:.
  Rat    24 NAEGIPIRTTLDNSTTVQYAGLLHQLTMK-AKSTVRDIDPQNDLTFLRIRSKKHEIMVAPDKEYL 87

  Fly   100 VTVV 103
            :.|:
  Rat    88 LIVI 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robl62ANP_001261256.1 Robl_LC7 24..103 CDD:214939 23/67 (34%)
Dynlrb2NP_001101921.1 Robl_LC7 3..93 CDD:397386 24/69 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4115
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10779
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.