DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl62A and robl37BC

DIOPT Version :9

Sequence 1:NP_001261256.1 Gene:robl62A / 38170 FlyBaseID:FBgn0028567 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_609931.1 Gene:robl37BC / 35166 FlyBaseID:FBgn0028569 Length:115 Species:Drosophila melanogaster


Alignment Length:60 Identity:18/60 - (30%)
Similarity:37/60 - (61%) Gaps:4/60 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 TTAQSIVKHLHASFLK----LAQSCVRDLDTDDKLCFLRVKTRKHEFLVSPEEAFTVTVV 103
            |...:.|..::|..::    ||:|.|:||:..|:|.::|::||:.|.:|:.|...|:.::
  Fly    34 TNLPANVARIYADRMRPLVILARSMVQDLENGDELSYVRLRTRRQETMVATENEHTIILI 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robl62ANP_001261256.1 Robl_LC7 24..103 CDD:214939 18/58 (31%)
robl37BCNP_609931.1 Robl_LC7 7..95 CDD:281277 18/60 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4115
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2020
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10779
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.