DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl62A and robl22E

DIOPT Version :9

Sequence 1:NP_001261256.1 Gene:robl62A / 38170 FlyBaseID:FBgn0028567 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_001259922.1 Gene:robl22E / 33412 FlyBaseID:FBgn0028570 Length:97 Species:Drosophila melanogaster


Alignment Length:100 Identity:27/100 - (27%)
Similarity:50/100 - (50%) Gaps:17/100 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MEDVVQRNTDNTNRITEQAQGFVVSENAGDSLLHTSFDLTTAQSIVKHLHASFL-----KLAQSC 68
            :|::::|.....|     ..|.||.:|.|.. :.|:.|.|..      ||.:.|     :.|:..
  Fly     5 VEELLKRFQSMKN-----VTGIVVVDNDGIP-IKTTLDYTLT------LHYAALMQTVREKARQV 57

  Fly    69 VRDLDTDDKLCFLRVKTRKHEFLVSPEEAFTVTVV 103
            |.|||..::..|||::|.::|.::.|:|.:.:.|:
  Fly    58 VLDLDATNEFTFLRLRTEQNEVMLCPQEDYFIMVI 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robl62ANP_001261256.1 Robl_LC7 24..103 CDD:214939 23/83 (28%)
robl22ENP_001259922.1 Robl_LC7 6..94 CDD:281277 27/98 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4115
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2020
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10779
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.