DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl62A and CG31275

DIOPT Version :9

Sequence 1:NP_001261256.1 Gene:robl62A / 38170 FlyBaseID:FBgn0028567 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_732175.1 Gene:CG31275 / 326131 FlyBaseID:FBgn0063261 Length:101 Species:Drosophila melanogaster


Alignment Length:98 Identity:48/98 - (48%)
Similarity:70/98 - (71%) Gaps:1/98 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KAMEDVVQRNTDNTNRI-TEQAQGFVVSENAGDSLLHTSFDLTTAQSIVKHLHASFLKLAQSCVR 70
            :.:|.|:.:|....:|| :|...|:|||:|..:::..||||.|:||:|:||||...:...||.||
  Fly     3 RILEKVIHQNGTIVDRILSEHTIGYVVSDNTANAVAETSFDNTSAQAILKHLHGLLVSTCQSVVR 67

  Fly    71 DLDTDDKLCFLRVKTRKHEFLVSPEEAFTVTVV 103
            |:|..:||||:|:.|||.|:||:|||.||:|||
  Fly    68 DIDPSNKLCFMRLGTRKFEYLVAPEEYFTITVV 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robl62ANP_001261256.1 Robl_LC7 24..103 CDD:214939 41/78 (53%)
CG31275NP_732175.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453835
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4115
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2020
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 1 1.000 - - FOG0019423
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10779
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.