DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl62A and Dynlrb1

DIOPT Version :9

Sequence 1:NP_001261256.1 Gene:robl62A / 38170 FlyBaseID:FBgn0028567 Length:104 Species:Drosophila melanogaster
Sequence 2:XP_038960100.1 Gene:Dynlrb1 / 170714 RGDID:619910 Length:119 Species:Rattus norvegicus


Alignment Length:75 Identity:24/75 - (32%)
Similarity:45/75 - (60%) Gaps:2/75 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GFVVSENAGDSLLHTSFDLTTAQSIVKHLHASFLKLAQSCVRDLDTDDKLCFLRVKTRKHEFLVS 93
            |..||...|..:..|..:.||.|  ..:|..:|:..|:|.||::|..:.|.|||::::|:|.:|:
  Rat    42 GAAVSVRDGIPIKSTMDNPTTTQ--YANLMHNFILKARSTVREIDPQNDLTFLRIRSKKNEIMVA 104

  Fly    94 PEEAFTVTVV 103
            |::.:.:.|:
  Rat   105 PDKDYFLIVI 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robl62ANP_001261256.1 Robl_LC7 24..103 CDD:214939 23/73 (32%)
Dynlrb1XP_038960100.1 Robl_LC7 42..114 CDD:214939 23/73 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4115
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.