DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stet and PCP1

DIOPT Version :9

Sequence 1:NP_788450.1 Gene:stet / 38169 FlyBaseID:FBgn0020248 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_011615.1 Gene:PCP1 / 852993 SGDID:S000003333 Length:346 Species:Saccharomyces cerevisiae


Alignment Length:203 Identity:53/203 - (26%)
Similarity:80/203 - (39%) Gaps:62/203 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 WRFL-FYMVL-----------------HAGWLHLGFNVAVQLVFGLPLEMVHGSTRIACIYFSGV 315
            |||| .||:|                 |..:.|||.|:.....||..|..:.|::....:|.:..
Yeast   166 WRFLQKYMLLQKDYVTSKISIIGSAFSHQEFWHLGMNMLALWSFGTSLATMLGASNFFSLYMNSA 230

  Fly   316 LAGSLGT---------SIFDPDVFLVGASG------GVYALLAAHLANVLLNYHQMRYGVIKLLH 365
            :||||.:         :|..|.   :||||      |.::.|..| |.:||....:..|      
Yeast   231 IAGSLFSLWYPKLARLAIVGPS---LGASGALFGVLGCFSYLFPH-AKILLFVFPVPGG------ 285

  Fly   366 ILVFVSFDFGFAIYARYAGDELQLGSSSEFLAIDQAETAGAVSYVAHLAGAIAGLTIGLLVLKSF 430
              .:|:|....|..|  ||..|:.||               ..|.|||.|::.|:..|..:.|:.
Yeast   286 --AWVAFLASVAWNA--AGCALRWGS---------------FDYAAHLGGSMMGVLYGWYISKAV 331

  Fly   431 EQKLHEQL 438
            |::...:|
Yeast   332 EKQRQRRL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stetNP_788450.1 EFh <75..115 CDD:298682
EF-hand_7 91..156 CDD:290234
Rhomboid 262..428 CDD:279958 50/191 (26%)
PCP1NP_011615.1 Rhomboid 186..329 CDD:396315 43/171 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.