DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stet and RBL2

DIOPT Version :9

Sequence 1:NP_788450.1 Gene:stet / 38169 FlyBaseID:FBgn0020248 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_176500.1 Gene:RBL2 / 842616 AraportID:AT1G63120 Length:317 Species:Arabidopsis thaliana


Alignment Length:199 Identity:50/199 - (25%)
Similarity:79/199 - (39%) Gaps:46/199 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 TLVELGFFVYHSVVTGEAAPRGPIPSDSMFIYRPDKRHEIWRFLFYMVLHAGWLHLGFNVAVQLV 293
            ||.::|...:..||                     ..|:.||.|..|.||||.:||..|:...:.
plant    92 TLEKMGALEWRKVV---------------------HEHQGWRLLSCMWLHAGIIHLLTNMLSLIF 135

  Fly   294 FGLPLEMVHGSTRIACIYFSGVLAGSLGTSIFDPDVFLVGASGGVYALLAAHLANVLLNYHQMRY 358
            .|:.||...|..|:..||....|.||:.:|:|..:...|||||.::.||.|.|:.:|.|:.....
plant   136 IGIRLEQQFGFIRVGLIYLISGLGGSILSSLFLQESISVGASGALFGLLGAMLSELLTNWTIYAN 200

  Fly   359 GVIKLLHILVFVSFDFGFAIYARYAGDELQLGSSSEFLAIDQAETAGAVSYVAHLAGAIAGLTIG 423
            ....|:.:|..::.:....:..|                         |...||:.|.:.|..:|
plant   201 KAAALITLLFIIAINLALGMLPR-------------------------VDNFAHIGGFLTGFCLG 240

  Fly   424 LLVL 427
            .::|
plant   241 FVLL 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stetNP_788450.1 EFh <75..115 CDD:298682
EF-hand_7 91..156 CDD:290234
Rhomboid 262..428 CDD:279958 45/166 (27%)
RBL2NP_176500.1 Rhomboid 105..244 CDD:279958 45/184 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1037
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.