DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stet and RBL10

DIOPT Version :9

Sequence 1:NP_788450.1 Gene:stet / 38169 FlyBaseID:FBgn0020248 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_173900.2 Gene:RBL10 / 839113 AraportID:AT1G25290 Length:343 Species:Arabidopsis thaliana


Alignment Length:127 Identity:32/127 - (25%)
Similarity:55/127 - (43%) Gaps:12/127 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 KRHEIWRFLFYMVLHAGWLHLGFNVAVQLVFGLPLEMVHGSTRIACIYFSGVLA-------GSLG 321
            :|.::||.....||||..:||..|.......|...|.:.|..|...:|.:..:|       ||..
plant   163 ERGQLWRLATASVLHANPMHLMINCYSLNSIGPTAESLGGPKRFLAVYLTSAVAKPILRVLGSAM 227

  Fly   322 TSIFD--PDVFLVGASGGVYALLAAHLANVLLNYHQMRYGVIKLLHILVFVSFDFGFAIYAR 381
            :..|:  |.   |||||.::.|:.:....|:.:...:|.|...|:.|...::.:....:.:|
plant   228 SYWFNKAPS---VGASGAIFGLVGSVAVFVIRHKQMVRGGNEDLMQIAQIIALNMAMGLMSR 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stetNP_788450.1 EFh <75..115 CDD:298682
EF-hand_7 91..156 CDD:290234
Rhomboid 262..428 CDD:279958 32/127 (25%)
RBL10NP_173900.2 Rhomboid 161..309 CDD:279958 32/127 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.