DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stet and AT5G38510

DIOPT Version :9

Sequence 1:NP_788450.1 Gene:stet / 38169 FlyBaseID:FBgn0020248 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001078681.1 Gene:AT5G38510 / 833839 AraportID:AT5G38510 Length:434 Species:Arabidopsis thaliana


Alignment Length:378 Identity:75/378 - (19%)
Similarity:135/378 - (35%) Gaps:117/378 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 AELRRELLRDKWKLLFDMF----------------DPEGFGEISVEEFLEALKSPEFLSQVPMNK 127
            |....::.:.:.|||...|                |.:...|::|.|.|::|.:  :|.:     
plant    69 ASSENKITKQRLKLLDSYFGKLQNDDEKPSISTGDDIDRKAELNVNEELDSLSA--YLDK----- 126

  Fly   128 RELLLERAKKAKLPTGPGYVTFQ-DFVNVMSGKRTRSFKCAVHHRDREVCSENDFQLVLNEPPLF 191
                |::..|:|     |.|:.. |.|....|        :|..:.|:...||:     |.|  |
plant   127 ----LQKDAKSK-----GLVSSTLDVVKSEGG--------SVASKLRKTGIENN-----NSP--F 167

  Fly   192 RKMVHAVAMEILPEERDR-----KYYADRYTCCPPPFFIILVTLVELGFFVYHSVVTGEAAPRGP 251
            ::.          ::.|:     .:||           :.::..:.:|..::      |||  .|
plant   168 QQF----------DDEDQAEDTLNFYA-----------VSILASINVGVCLF------EAA--AP 203

  Fly   252 IPSDSM------FIYRPDKRH-----EIWRFLFYMVLHAGWLHLGFNVAVQLVFGLPLEMVHGST 305
            :.:::|      .:|......     |.||.:..|.||:|..|:..:....|.||..:...:|..
plant   204 VRNNNMGLLSLPLLYGAKINDLILAGEWWRLVTPMFLHSGIPHVALSSWALLTFGPKVCRDYGLF 268

  Fly   306 RIACIYFSGVLAGSLGTSIFDPDVFLVGASGGVYALLAAHLANVLLNYHQMRYGVIKLLHILVFV 370
            ....||..|.::|:..:.:...|. .||.:|..:||:.|.|.:...|...::....:.|.....:
plant   269 TFCLIYILGGVSGNFMSFLHTADP-TVGGTGPAFALIGAWLVDQNQNKEMIKSNEYEDLFQKAII 332

  Fly   371 SFDFGFAIYARYAGDELQLGSSSEFLAIDQAETAGAVSYVAHLAGAIAGLTIG 423
            ...||..:              |.|..||.....||:         |||:..|
plant   333 MTGFGLIL--------------SHFGPIDDWTNLGAL---------IAGIVYG 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stetNP_788450.1 EFh <75..115 CDD:298682 10/51 (20%)
EF-hand_7 91..156 CDD:290234 18/81 (22%)
Rhomboid 262..428 CDD:279958 38/167 (23%)
AT5G38510NP_001078681.1 Rhomboid 225..367 CDD:396315 38/162 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.