DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stet and RBL3

DIOPT Version :9

Sequence 1:NP_788450.1 Gene:stet / 38169 FlyBaseID:FBgn0020248 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_196342.1 Gene:RBL3 / 830616 AraportID:AT5G07250 Length:346 Species:Arabidopsis thaliana


Alignment Length:361 Identity:82/361 - (22%)
Similarity:134/361 - (37%) Gaps:93/361 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 DFVNVMSGKRTRSFKCAVHHRDREVCSENDFQLVLNEPPLFRKMVHAVAMEILPEERDRKYYADR 215
            |..|.||.|            ||.:.|....:..:..|||      .||:....|..|.. .:.|
plant     7 DLENRMSAK------------DRGIGSRGGDRNRIGPPPL------PVALSSSTEFGDNA-LSSR 52

  Fly   216 YTCCPPPFFIIL-VTLVELGFFVY-------------HSV------VTGEAAPRGPI--PSD--- 255
            :|....|.|::. |.:..:..||.             |.|      ::.|.....|:  ||.   
plant    53 WTSWLVPMFVVANVAVFVVAMFVNNCPNHFESHRLRGHCVAKFLGRLSFEPLRTNPLFGPSSHTL 117

  Fly   256 ----SMFIYRPDKRHEIWRFLFYMVLHAGWLHLGFNVAVQLVFGLPLEMVHGSTRIACIYFSGVL 316
                ::...:..::.|.||.|..:.||||.:|||.|:...:..|:.||...|..||..||....:
plant   118 EKLGALEWSKVVEKKEGWRLLTCIWLHAGVIHLGANMLSLVFIGIRLEQQFGFVRIGVIYLLSGI 182

  Fly   317 AGSLGTSIFDPDVFLVGASGGVYALLAAHLANVLLNYHQMRYGVIKLLHILVFVSFDFGFAIYAR 381
            .||:.:|:|..:...|||||.::.||.:.|:.:..|:......:..||.:|..:..:....|...
plant   183 GGSVLSSLFIRNSISVGASGALFGLLGSMLSELFTNWTIYSNKIAALLTLLFVILINLAIGILPH 247

  Fly   382 YAGDELQLGSSSEFLAIDQAETAGAVSYVAHLAGAIAGLTIGLLVLK------------------ 428
                                     |...||:.|.:.|..:|.::|.                  
plant   248 -------------------------VDNFAHVGGFVTGFLLGFILLARPQFKWLAREHMPQGTPL 287

  Fly   429 SFEQKLHEQLLWWIALGTYLA--LVVFAIAFNIMNG 462
            .::.|.::.|||.::|...:|  :|...:.|...||
plant   288 RYKYKTYQYLLWLLSLVLLIAGFVVALLMLFRGENG 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stetNP_788450.1 EFh <75..115 CDD:298682
EF-hand_7 91..156 CDD:290234 2/4 (50%)
Rhomboid 262..428 CDD:279958 43/165 (26%)
RBL3NP_196342.1 Rhomboid 128..269 CDD:396315 43/165 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1037
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.