DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stet and RBL7

DIOPT Version :9

Sequence 1:NP_788450.1 Gene:stet / 38169 FlyBaseID:FBgn0020248 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_194038.1 Gene:RBL7 / 828406 AraportID:AT4G23070 Length:313 Species:Arabidopsis thaliana


Alignment Length:243 Identity:65/243 - (26%)
Similarity:94/243 - (38%) Gaps:60/243 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 YYADRYTCCPPPFFIILVTLVELGFFVYHSVVTGEAAPRGPI--PSDSMFIYRPDK--------- 264
            ||.|    ||......|...  ||.|.:      |:....|:  ||.|..    :|         
plant    50 YYND----CPHKSHRCLAKF--LGRFSF------ESFKSNPLLGPSSSTL----EKMGALAWGKI 98

  Fly   265 --RHEIWRFLFYMVLHAGWLHLGFNVAVQLVFGLPLEMVHGSTRIACIYFSGVLAGSLGTSIFDP 327
              :.::||.|..|.||||.:||..|:......|:.||...|..|:..||......||:.:.:|..
plant    99 VHKRQVWRLLTCMWLHAGVIHLLANMCCVAYIGVRLEQQFGFVRVGTIYLVSGFCGSILSCLFLE 163

  Fly   328 DVFLVGASGGVYALLAAHLANVLLNYHQMRYGVIKLLHILVFVSFDFGFAIYARYAGDELQLGSS 392
            |...||||..::.||.|.|:.:|:|:.......:.::.:||.|..:.|             ||  
plant   164 DAISVGASSALFGLLGAMLSELLINWTTYDNKGVAIVMLLVIVGVNLG-------------LG-- 213

  Fly   393 SEFLAIDQAETAGAVSYVAHLAGAIAGLTIGLLVLKSFEQKLHEQLLW 440
                      |...|...||:.|...|..:|.|:|      :|.|..|
plant   214 ----------TLPPVDNFAHIGGFFGGFLLGFLLL------IHPQFEW 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stetNP_788450.1 EFh <75..115 CDD:298682
EF-hand_7 91..156 CDD:290234
Rhomboid 262..428 CDD:279958 47/176 (27%)
RBL7NP_194038.1 Rhomboid 98..224 CDD:396315 41/150 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1037
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.