DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stet and RBL4

DIOPT Version :9

Sequence 1:NP_788450.1 Gene:stet / 38169 FlyBaseID:FBgn0020248 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_850698.1 Gene:RBL4 / 824545 AraportID:AT3G53780 Length:394 Species:Arabidopsis thaliana


Alignment Length:217 Identity:52/217 - (23%)
Similarity:88/217 - (40%) Gaps:43/217 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 KRHEIWRFLFYMVLHAGWLHLGFNVAVQLVFGLPLEMVHGSTRIACIYFSGVLAGSLGTSIFDPD 328
            |..|.||.|....||.|.:||..|:...|..|:.:|...|..||..:|......||:.:::|...
plant   135 KGDEGWRLLSCNWLHGGVVHLLMNMLTLLFIGIRMEREFGFIRIGLLYLISGFGGSILSALFLRS 199

  Fly   329 VFLVGASGGVYALLAAHLANVLLNYHQMRYGVIKLLHILVFVSFDFGFAIYARYAGDELQLGSSS 393
            ...|||||.|:.||...|:.:.:|:......|:.::.:::.|:.:.|..:..             
plant   200 NISVGASGAVFGLLGGMLSEIFINWTIYSNKVVTIVTLVLIVAVNLGLGVLP------------- 251

  Fly   394 EFLAIDQAETAGAVSYVAHLAGAIAGLTIGLLVL----------------KSFEQKLHEQLLWWI 442
                        .|...||:.|...|..:|.::|                |....|:::.:||.|
plant   252 ------------GVDNFAHIGGFATGFLLGFVLLIRPHYGWINQRNGPGAKPHRFKIYQGILWTI 304

  Fly   443 ALGTYLA--LVVFAIAFNIMNG 462
            :|...:|  :|.....||.::|
plant   305 SLLILVAGFIVGLISLFNNVDG 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stetNP_788450.1 EFh <75..115 CDD:298682
EF-hand_7 91..156 CDD:290234
Rhomboid 262..428 CDD:279958 41/179 (23%)
RBL4NP_850698.1 Rhomboid 133..273 CDD:396315 40/162 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1037
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.