Sequence 1: | NP_788450.1 | Gene: | stet / 38169 | FlyBaseID: | FBgn0020248 | Length: | 485 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005164392.1 | Gene: | rhbdf1a / 798402 | ZFINID: | ZDB-GENE-040704-75 | Length: | 893 | Species: | Danio rerio |
Alignment Length: | 202 | Identity: | 53/202 - (26%) |
---|---|---|---|
Similarity: | 88/202 - (43%) | Gaps: | 42/202 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 262 PDKRHEIWRFLFYMVLHAGWLHLGFNVAVQLVFGLPLEMVHGSTRIACIYFSGVLAGSLGTSIFD 326
Fly 327 PDVFLVGASGGVYALLAAHLANVLLNYH---QMRYGVIKLLHILVFVSFDFGFAIYARYAGDELQ 388
Fly 389 LGSSSEFLAIDQAETAGAVSYVAHLAGAIAG--LTIGLLVLKSF-----EQKLHEQLLWWIA-LG 445
Fly 446 TYLALVV 452 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
stet | NP_788450.1 | EFh | <75..115 | CDD:298682 | |
EF-hand_7 | 91..156 | CDD:290234 | |||
Rhomboid | 262..428 | CDD:279958 | 45/170 (26%) | ||
rhbdf1a | XP_005164392.1 | Rhomboid_SP | 130..347 | CDD:289371 | |
Rhomboid | 685..826 | CDD:279958 | 44/168 (26%) | ||
DUF805 | <792..864 | CDD:294752 | 19/95 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0705 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1253228at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.820 |