DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stet and rhbdf1a

DIOPT Version :9

Sequence 1:NP_788450.1 Gene:stet / 38169 FlyBaseID:FBgn0020248 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_005164392.1 Gene:rhbdf1a / 798402 ZFINID:ZDB-GENE-040704-75 Length:893 Species:Danio rerio


Alignment Length:202 Identity:53/202 - (26%)
Similarity:88/202 - (43%) Gaps:42/202 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 PDKRHEIWRFLFYMVLHAGWLHLGFNVAVQLVFGLPLEMVHGSTRIACIYFSGVLAGSLGTSIFD 326
            ||:.:.:|..||   ||||.||...:|..|:.....||.:.|..||:.||....:.|:|.::||.
Zfish   688 PDQFYRLWLSLF---LHAGILHCLVSVCFQMTILRDLEKLAGWLRISIIYILSGITGNLASAIFL 749

  Fly   327 PDVFLVGASGGVYALLAAHLANVLLNYH---QMRYGVIKLLHILVFVSFDFGFAIYARYAGDELQ 388
            |....||.:|..:.:||.....::.::.   |......|||.:::|: |.||...:         
Zfish   750 PYRAEVGPAGSQFGILACLFVELIQSWQILAQPWRAFTKLLCVVLFL-FAFGLLPW--------- 804

  Fly   389 LGSSSEFLAIDQAETAGAVSYVAHLAGAIAG--LTIGLLVLKSF-----EQKLHEQLLWWIA-LG 445
                              :...||::|.|:|  |:...|...||     .:|..:.:::.:. ||
Zfish   805 ------------------IDNFAHISGFISGFFLSFAFLPYISFGRLDMYRKRCQIIIFLVVFLG 851

  Fly   446 TYLALVV 452
            .:..|||
Zfish   852 LFAGLVV 858

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stetNP_788450.1 EFh <75..115 CDD:298682
EF-hand_7 91..156 CDD:290234
Rhomboid 262..428 CDD:279958 45/170 (26%)
rhbdf1aXP_005164392.1 Rhomboid_SP 130..347 CDD:289371
Rhomboid 685..826 CDD:279958 44/168 (26%)
DUF805 <792..864 CDD:294752 19/95 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.