DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stet and RHBDF2

DIOPT Version :9

Sequence 1:NP_788450.1 Gene:stet / 38169 FlyBaseID:FBgn0020248 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_078875.4 Gene:RHBDF2 / 79651 HGNCID:20788 Length:856 Species:Homo sapiens


Alignment Length:209 Identity:53/209 - (25%)
Similarity:86/209 - (41%) Gaps:42/209 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 PDKRHEIWRFLFYMVLHAGWLHLGFNVAVQLVFGLPLEMVHGSTRIACIYFSGVLAGSLGTSIFD 326
            ||:.:.:|..||   ||||.:|...:|..|:.....||.:.|..|||.|:....:.|:|.::||.
Human   651 PDQFYRLWLSLF---LHAGVVHCLVSVVFQMTILRDLEKLAGWHRIAIIFILSGITGNLASAIFL 712

  Fly   327 PDVFLVGASGGVYALLAAHLANVLLNYHQMRYGVIKLLHILVFVSFDFGFAIYARYAGDELQLGS 391
            |....||.:|..:.|||.                       :||.....:.:..|.....|.|.:
Human   713 PYRAEVGPAGSQFGLLAC-----------------------LFVELFQSWPLLERPWKAFLNLSA 754

  Fly   392 SSEFLAIDQAETAGAVSY---VAHLAGAIAGLTIGLLVLK----SFEQKLHEQLLWWIAL----G 445
            ...||.|     .|.:.:   :||:.|.::||.:....|.    ....|..::.|..::|    |
Human   755 IVLFLFI-----CGLLPWIDNIAHIFGFLSGLLLAFAFLPYITFGTSDKYRKRALILVSLLAFAG 814

  Fly   446 TYLALVVFAIAFNI 459
            .:.|||::...:.|
Human   815 LFAALVLWLYIYPI 828

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stetNP_788450.1 EFh <75..115 CDD:298682
EF-hand_7 91..156 CDD:290234
Rhomboid 262..428 CDD:279958 44/168 (26%)
RHBDF2NP_078875.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115
Rhomboid_SP 128..334 CDD:289371
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..184
Involved in interaction with FRMD8. /evidence=ECO:0000269|PubMed:29897333 191..271
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 531..553
Rhomboid 648..789 CDD:279958 44/168 (26%)
GtrA 748..832 CDD:303012 20/86 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.