DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stet and parl

DIOPT Version :9

Sequence 1:NP_788450.1 Gene:stet / 38169 FlyBaseID:FBgn0020248 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_021322181.1 Gene:parl / 792889 -ID:- Length:361 Species:Danio rerio


Alignment Length:206 Identity:47/206 - (22%)
Similarity:70/206 - (33%) Gaps:70/206 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 FIYRPDKRHEIWRFLFYMVLHAGWLHLGFNVAVQLVFGLPLEMVHGSTRIACIYFS-GVLA---- 317
            |...|..:...|..|.....|....||..|:.|...|...:..:.|..:...:|.| ||::    
Zfish   177 FTSNPSSKALCWPMLLSTFSHYSLFHLSANMYVLWSFSSSIINMMGKEQFMALYLSTGVISTFVS 241

  Fly   318 -------GSLGTSIFDPDVFLVGASGGVYALLAAHLANVLLNYHQMRYGVIKLLHILVFVSFDFG 375
                   |.||.|:        ||||.:.|:|||    |.....:.:..:|.|            
Zfish   242 YVSKTAMGRLGPSL--------GASGAIMAVLAA----VCTKMPEAKLAIIFL------------ 282

  Fly   376 FAIYARYAGDELQLGSSSEFLAIDQAETAGAV------SYVAHLAGAIAGLTIGLLVLKSFEQKL 434
             .:|...||:.|:        ||...:|.|.:      .:.|||.||:.|               
Zfish   283 -PMYTFTAGNALK--------AIVALDTTGLILGWRFFDHAAHLGGALFG--------------- 323

  Fly   435 HEQLLWWIALG 445
                :|:|..|
Zfish   324 ----IWYIIYG 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stetNP_788450.1 EFh <75..115 CDD:298682
EF-hand_7 91..156 CDD:290234
Rhomboid 262..428 CDD:279958 43/183 (23%)
parlXP_021322181.1 Rhomboid 188..335 CDD:307698 45/195 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.