DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stet and rhbdl2

DIOPT Version :9

Sequence 1:NP_788450.1 Gene:stet / 38169 FlyBaseID:FBgn0020248 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001016521.1 Gene:rhbdl2 / 549275 XenbaseID:XB-GENE-992044 Length:290 Species:Xenopus tropicalis


Alignment Length:276 Identity:114/276 - (41%)
Similarity:163/276 - (59%) Gaps:31/276 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 KMVHAVAMEILPEERDRKYYADRYTCCPPPFFIILVTLVELGFFVYHSV-------VTGEAAPRG 250
            |:...::..|||..: |..|.:|..|.|||.|||.|::.||..|:|::|       :|.:..   
 Frog    31 KIHETISNWILPTNQ-RDTYLERANCLPPPIFIISVSIAELAVFIYYAVWMPQKQWITLDTG--- 91

  Fly   251 PIPSDSMFIYRPDKRHEIWRFLFYMVLHAGWLHLGFNVAVQLVFGLPLEMVHGSTRIACIYFSGV 315
              ..:|.||||||||.|.|||:.||::|||..|:..|:|:||:.|:|||:||...||..:|.:||
 Frog    92 --VWNSPFIYRPDKREEAWRFISYMMVHAGVQHIIGNLALQLLLGIPLELVHKGHRIGLVYLAGV 154

  Fly   316 LAGSLGTSIFDPDVFLVGASGGVYALLAAHLANVLLNYHQM--RYGVIKLLHILVFVSFDFGFAI 378
            :.|||.:|:||..:.|||||||||||:..:..|||:|:..|  .:|:.::|.|:..|..|.|||:
 Frog   155 IGGSLASSVFDSGLALVGASGGVYALIGGYFMNVLVNFKDMIPLFGIFRILVIITIVGTDVGFAL 219

  Fly   379 YARYAGDELQLGSSSEFLAIDQAETAGAVSYVAHLAGAIAGLTIGLLVLKSFEQKLHEQLLWWIA 443
            |.||...                ||...||:|||.||.:||::||..|...|::.|.:...:||.
 Frog   220 YRRYISH----------------ETGQKVSFVAHFAGGLAGMSIGYTVFSCFDKNLIKDPRFWIC 268

  Fly   444 LGTYLALVVFAIAFNI 459
            :..|.|.|:||:.|||
 Frog   269 IAAYAAFVIFAVLFNI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stetNP_788450.1 EFh <75..115 CDD:298682
EF-hand_7 91..156 CDD:290234
Rhomboid 262..428 CDD:279958 76/167 (46%)
rhbdl2NP_001016521.1 Rhomboid 103..252 CDD:366759 73/164 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 146 1.000 Domainoid score I4515
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45840
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.