DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stet and ru

DIOPT Version :9

Sequence 1:NP_788450.1 Gene:stet / 38169 FlyBaseID:FBgn0020248 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_524790.1 Gene:ru / 44856 FlyBaseID:FBgn0003295 Length:341 Species:Drosophila melanogaster


Alignment Length:241 Identity:125/241 - (51%)
Similarity:171/241 - (70%) Gaps:22/241 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 PPFFIILVTLVELGFFVYHSVVTGEAAPRGPIPSDSMFIYRPDKRHEIWRFLFYMVLHAGWLHLG 285
            |||||||.||:|:..|::..     |.|    |.||:.:||||:|.::||||.|.:|||.|||||
  Fly    97 PPFFIILATLLEVLVFLWVG-----ADP----PEDSLLVYRPDQRLQLWRFLSYALLHASWLHLG 152

  Fly   286 FNVAVQLVFGLPLEMVHGSTRIACIYFSGVLAGSLGTSIFDPDVFLVGASGGVYALLAAHLANVL 350
            :||..||:||:|||:||||.|...||.:||||||||||:.|.:||||||||||||||||.||::|
  Fly   153 YNVLTQLLFGVPLELVHGSLRTGVIYMAGVLAGSLGTSVVDSEVFLVGASGGVYALLAAQLASLL 217

  Fly   351 LNYHQMRYGVIKLLHILVFVSFDFGFAIYARYAGDELQLGSSSEFLAIDQAETAGAVSYVAHLAG 415
            ||:.|||:|||:|:.:::||..|.|:|:|:|.             ||:.|.:|..:|||:||:.|
  Fly   218 LNFGQMRHGVIQLMAVILFVFCDLGYALYSRE-------------LAMHQLQTRPSVSYIAHMTG 269

  Fly   416 AIAGLTIGLLVLKSFEQKLHEQLLWWIALGTYLALVVFAIAFNIMN 461
            |:||:::|||:|:..:..|..:.|.|:|||.:.....|.||||::|
  Fly   270 ALAGISVGLLLLRQLDGGLRPRPLRWLALGVWCIFSAFGIAFNLVN 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stetNP_788450.1 EFh <75..115 CDD:298682
EF-hand_7 91..156 CDD:290234
Rhomboid 262..428 CDD:279958 94/165 (57%)
ruNP_524790.1 Rhomboid 129..282 CDD:279958 94/165 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457248
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5174
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102232at50557
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 1 1.000 - - mtm1037
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.