DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stet and rho

DIOPT Version :10

Sequence 1:NP_788450.1 Gene:stet / 38169 FlyBaseID:FBgn0020248 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_523883.2 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster


Alignment Length:295 Identity:139/295 - (47%)
Similarity:188/295 - (63%) Gaps:24/295 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 AVAMEILPEERD---RKYYADRYTCCPPPFFIILVTLVELGFFVYHSVVTGEAAPRG---PIPSD 255
            |:....|||..|   .||...::.    |:||::::::|:..|.|.. .|..|...|   |||||
  Fly    78 AIPATPLPESEDIGLLKYVHRQHW----PWFILVISIIEIAIFAYDR-YTMPAQNFGLPVPIPSD 137

  Fly   256 SMFIYRPDKRHEIWRFLFYMVLHAGWLHLGFNVAVQLVFGLPLEMVHGSTRIACIYFSGVLAGSL 320
            |:.:||||:|.::|||..||.|||.|.|||||:.:||.||:|||::||:.||..||.:||.||||
  Fly   138 SVLVYRPDRRLQVWRFFSYMFLHANWFHLGFNIVIQLFFGIPLEVMHGTARIGVIYMAGVFAGSL 202

  Fly   321 GTSIFDPDVFLVGASGGVYALLAAHLANVLLNYHQMRYGVIKLLHILVFVSFDFGFAIYARYAGD 385
            |||:.|.:||||||||||||||||||||:.|||..|:....:|..:::|||.|.|:|:|.:|.  
  Fly   203 GTSVVDSEVFLVGASGGVYALLAAHLANITLNYAHMKSASTQLGSVVIFVSCDLGYALYTQYF-- 265

  Fly   386 ELQLGSSSEFLAIDQAETAGAVSYVAHLAGAIAGLTIGLLVLKSFEQKLHEQLLWWIALGTYLAL 450
                 ..|.|....|      |||:|||.||:||||||.||||:|..:.:|||:||:|||.|.|.
  Fly   266 -----DGSAFAKGPQ------VSYIAHLTGALAGLTIGFLVLKNFGHREYEQLIWWLALGVYCAF 319

  Fly   451 VVFAIAFNIMNGFAMFNIRVEKIRVTETIFNDFQV 485
            .||||.||::|......:..:...:|:.:.:|..|
  Fly   320 TVFAIVFNLINTVTAQLMEEQGEVITQHLLHDLGV 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stetNP_788450.1 EF-hand_7 87..157 CDD:463900
Rhomboid 262..428 CDD:426384 92/165 (56%)
rhoNP_523883.2 Rhomboid 144..297 CDD:426384 92/165 (56%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.