DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stet and rho

DIOPT Version :9

Sequence 1:NP_788450.1 Gene:stet / 38169 FlyBaseID:FBgn0020248 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster


Alignment Length:295 Identity:139/295 - (47%)
Similarity:188/295 - (63%) Gaps:24/295 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 AVAMEILPEERD---RKYYADRYTCCPPPFFIILVTLVELGFFVYHSVVTGEAAPRG---PIPSD 255
            |:....|||..|   .||...::.    |:||::::::|:..|.|.. .|..|...|   |||||
  Fly    78 AIPATPLPESEDIGLLKYVHRQHW----PWFILVISIIEIAIFAYDR-YTMPAQNFGLPVPIPSD 137

  Fly   256 SMFIYRPDKRHEIWRFLFYMVLHAGWLHLGFNVAVQLVFGLPLEMVHGSTRIACIYFSGVLAGSL 320
            |:.:||||:|.::|||..||.|||.|.|||||:.:||.||:|||::||:.||..||.:||.||||
  Fly   138 SVLVYRPDRRLQVWRFFSYMFLHANWFHLGFNIVIQLFFGIPLEVMHGTARIGVIYMAGVFAGSL 202

  Fly   321 GTSIFDPDVFLVGASGGVYALLAAHLANVLLNYHQMRYGVIKLLHILVFVSFDFGFAIYARYAGD 385
            |||:.|.:||||||||||||||||||||:.|||..|:....:|..:::|||.|.|:|:|.:|.  
  Fly   203 GTSVVDSEVFLVGASGGVYALLAAHLANITLNYAHMKSASTQLGSVVIFVSCDLGYALYTQYF-- 265

  Fly   386 ELQLGSSSEFLAIDQAETAGAVSYVAHLAGAIAGLTIGLLVLKSFEQKLHEQLLWWIALGTYLAL 450
                 ..|.|....|      |||:|||.||:||||||.||||:|..:.:|||:||:|||.|.|.
  Fly   266 -----DGSAFAKGPQ------VSYIAHLTGALAGLTIGFLVLKNFGHREYEQLIWWLALGVYCAF 319

  Fly   451 VVFAIAFNIMNGFAMFNIRVEKIRVTETIFNDFQV 485
            .||||.||::|......:..:...:|:.:.:|..|
  Fly   320 TVFAIVFNLINTVTAQLMEEQGEVITQHLLHDLGV 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stetNP_788450.1 EFh <75..115 CDD:298682
EF-hand_7 91..156 CDD:290234
Rhomboid 262..428 CDD:279958 92/165 (56%)
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 92/165 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457249
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5174
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102232at50557
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 1 1.000 - - mtm6530
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.