DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stet and rho-7

DIOPT Version :9

Sequence 1:NP_788450.1 Gene:stet / 38169 FlyBaseID:FBgn0020248 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001286324.1 Gene:rho-7 / 36281 FlyBaseID:FBgn0033672 Length:351 Species:Drosophila melanogaster


Alignment Length:222 Identity:47/222 - (21%)
Similarity:73/222 - (32%) Gaps:54/222 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 IILVTLVELGFFVYHSVVTGEAAPRGPIPSDSMFIY---RPDKRHEIWRFLFYMVLHAGWLHLGF 286
            |:|..||....:            |.|....:|..|   .|..:...|........|...:||..
  Fly   151 ILLCNLVAFAMW------------RVPALKSTMITYFTSNPAAKVVCWPMFLSTFSHYSAMHLFA 203

  Fly   287 NVAVQLVFGLPLEMVHGSTRIACIYFSGVLAGSLGTSIFDPDVFLVGASGGVYALLAAHLANVLL 351
            |:.|...|.....:..|..:...:|.|..:..||.:.::.......|.|.|....:...||.|..
  Fly   204 NMYVMHSFANAAAVSLGKEQFLAVYLSAGVFSSLMSVLYKAATSQAGMSLGASGAIMTLLAYVCT 268

  Fly   352 NYHQMRYGVIKLLHILVFVSFDFGFAIYARYAGDELQLGSSSEFLAIDQAETAGAV------SYV 410
            .|...:..::    .|..::|..|       ||.::.:|          .:.||.|      .:.
  Fly   269 QYPDTQLSIL----FLPALTFSAG-------AGIKVLMG----------IDFAGVVMGWKFFDHA 312

  Fly   411 AHLAGAIAGL------------TIGLL 425
            |||.||:.|:            .||||
  Fly   313 AHLGGAMFGIFWATYGAQIWAKRIGLL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stetNP_788450.1 EFh <75..115 CDD:298682
EF-hand_7 91..156 CDD:290234
Rhomboid 262..428 CDD:279958 39/182 (21%)
rho-7NP_001286324.1 Rhomboid 186..327 CDD:396315 34/161 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444959
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.