DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stet and Rhbdf2

DIOPT Version :9

Sequence 1:NP_788450.1 Gene:stet / 38169 FlyBaseID:FBgn0020248 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001100537.2 Gene:Rhbdf2 / 303690 RGDID:1309699 Length:825 Species:Rattus norvegicus


Alignment Length:209 Identity:48/209 - (22%)
Similarity:81/209 - (38%) Gaps:56/209 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 PDKRHEIWRFLFYMVLHAGWLHLGFNVAVQLVFGLPLEMVHGSTRIACIYFSGVLAGSLGTSIFD 326
            ||:.:.||..||   ||||.:|...:|..|:.....||.:.|..||:.|:....:.|:|.::||.
  Rat   620 PDQFYRIWLSLF---LHAGIVHCLVSVVFQMTILRDLEKLAGWHRISIIFILSGITGNLASAIFL 681

  Fly   327 PDVFLVGASGGVYALLAAHLANVLLNYHQMR---YGVIKLLHILVFVSFDFGFAIYARYAGDELQ 388
            |....||.:|..:.|||.....:..::..:.   .....|..|::|: |..|...:         
  Rat   682 PYRAEVGPAGSQFGLLACLFVELFQSWQLLERPWKAFFNLSAIVLFL-FICGLLPW--------- 736

  Fly   389 LGSSSEFLAIDQAETAGAVSYVAHLAGAIAGLTIGLLVLKSFEQKLHEQLLWWIALGT------- 446
                              :..:||:.|.::|:.:....|.            :|..||       
  Rat   737 ------------------IDNIAHIFGFLSGMLLAFAFLP------------YITFGTSDRYRKQ 771

  Fly   447 ---YLALVVFAIAF 457
               .::|:|||..|
  Rat   772 ALILVSLLVFAGLF 785

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stetNP_788450.1 EFh <75..115 CDD:298682
EF-hand_7 91..156 CDD:290234
Rhomboid 262..428 CDD:279958 39/168 (23%)
Rhbdf2NP_001100537.2 Rhomboid_SP 98..302 CDD:403706
Rhomboid 617..758 CDD:396315 39/168 (23%)
MFS 718..>808 CDD:421695 18/108 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.