DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stet and Rhbdf1

DIOPT Version :9

Sequence 1:NP_788450.1 Gene:stet / 38169 FlyBaseID:FBgn0020248 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_038941805.1 Gene:Rhbdf1 / 303008 RGDID:1305075 Length:907 Species:Rattus norvegicus


Alignment Length:224 Identity:52/224 - (23%)
Similarity:91/224 - (40%) Gaps:57/224 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 PDKRHEIWRFLFYMVLHAGWLHLGFNVAVQLVFGLPLEMVHGSTRIACIYFSGVLAGSLGTSIFD 326
            ||:.:.:|..||   ||||.||...:|..|:.....||.:.|..|||.||....:.|:|.::||.
  Rat   702 PDQFYRLWLSLF---LHAGILHCLVSVCFQMTVLRDLEKLAGWHRIAIIYLLSGVTGNLASAIFL 763

  Fly   327 PDVFLVGASGGVYALLAAHLANVLLNYHQMR---YGVIKLLHILVFVSFDFGFAIYARYAGDELQ 388
            |....||.:|..:.:||.....:..::..:.   ....|||.:::|: |.||...:         
  Rat   764 PYRAEVGPAGSQFGILACLFVELFQSWQILARPWRAFFKLLAVVLFL-FAFGLLPW--------- 818

  Fly   389 LGSSSEFLAIDQAETAGAVSYVAHLAGAIAGLTIGLLVLKSFEQKLHEQLLWWIALGTY------ 447
                              :...||::|.::||.:....|.            :|:.|.:      
  Rat   819 ------------------IDNFAHISGFVSGLFLSFAFLP------------YISFGKFDLYRKR 853

  Fly   448 LALVVF-AIAFNIMNG----FAMFNIRVE 471
            ..:::| |:...::.|    |..:.:|.|
  Rat   854 CQIIIFQAVFLGLLAGLVVLFYFYPVRCE 882

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stetNP_788450.1 EFh <75..115 CDD:298682
EF-hand_7 91..156 CDD:290234
Rhomboid 262..428 CDD:279958 43/168 (26%)
Rhbdf1XP_038941805.1 Rhomboid_SP 142..359 CDD:403706
Rhomboid 699..840 CDD:396315 43/168 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.