DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stet and Rhbdl2

DIOPT Version :9

Sequence 1:NP_788450.1 Gene:stet / 38169 FlyBaseID:FBgn0020248 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_038965543.1 Gene:Rhbdl2 / 298512 RGDID:1308295 Length:302 Species:Rattus norvegicus


Alignment Length:280 Identity:114/280 - (40%)
Similarity:172/280 - (61%) Gaps:31/280 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 PLFRKMVHAVAMEILPEERDRKYYADRYTCCPPPFFIILVTLVELGFFVYHSV-------VTGEA 246
            |..||:...|:..:|||. .|:.|.:|..|.|||.||:|::|.||..|:|::|       :|.:.
  Rat    39 PRGRKVHRIVSKWMLPEP-VRRTYLERANCLPPPLFIVLISLAELAVFIYYAVWKPQKQWITLDT 102

  Fly   247 APRGPIPSDSMFIYRPDKRHEIWRFLFYMVLHAGWLHLGFNVAVQLVFGLPLEMVHGSTRIACIY 311
               |.:  :|...|||:||.|.|||:.||::|||..|:..|:.:|||.|:||||||...|:..:|
  Rat   103 ---GIL--ESPLTYRPEKREEAWRFISYMLVHAGVQHIVGNLFMQLVLGIPLEMVHKGLRVGLVY 162

  Fly   312 FSGVLAGSLGTSIFDPDVFLVGASGGVYALLAAHLANVLLNYHQM--RYGVIKLLHILVFVSFDF 374
            .:|||||||.:|||||...|||||||||||:..:..||::|:.:|  ..|:::||.|::.|:.|.
  Rat   163 LAGVLAGSLASSIFDPLKSLVGASGGVYALMGGYFMNVIVNFREMIPALGIVRLLVIILIVASDM 227

  Fly   375 GFAIYARYAGDELQLGSSSEFLAIDQAETAGAVSYVAHLAGAIAGLTIGLLVLKSFEQKLHEQLL 439
            |||:|.|:            |:..:    ...||:.||:||..||:::|..|...|::.|.:...
  Rat   228 GFALYRRF------------FVPAN----GSPVSFAAHIAGGFAGMSVGYTVFSCFDKTLLKDPR 276

  Fly   440 WWIALGTYLALVVFAIAFNI 459
            :||::..|:|.::||:.|||
  Rat   277 FWISIAAYVACLLFAVFFNI 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stetNP_788450.1 EFh <75..115 CDD:298682
EF-hand_7 91..156 CDD:290234
Rhomboid 262..428 CDD:279958 75/167 (45%)
Rhbdl2XP_038965543.1 Rhomboid 113..265 CDD:396315 75/167 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.