DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stet and rom-3

DIOPT Version :9

Sequence 1:NP_788450.1 Gene:stet / 38169 FlyBaseID:FBgn0020248 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_503013.2 Gene:rom-3 / 191000 WormBaseID:WBGene00004402 Length:861 Species:Caenorhabditis elegans


Alignment Length:272 Identity:60/272 - (22%)
Similarity:114/272 - (41%) Gaps:60/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 GPIPSDSMFIYRPDKRHEIWRFLFYMVLHAGWLHLGFNVAVQLVFGLPLEMVHGSTRIACIYFSG 314
            |.||     .:..|..::|:|....:.:|||.:||..::|.|:.|....|.:.||.|:|.:||:.
 Worm   572 GMIP-----FFSGDNPNQIYRLFTSLFIHAGVIHLALSMAFQMYFMAYQENLIGSKRMAILYFAS 631

  Fly   315 VLAGSLGTSIFDPDVFLVGASG---GVYALLAA---HLANVL----LNYHQMRYGVIKLL----- 364
            .::|:|.::||.|....||.|.   ||::.:..   |..::|    |.:..:.:.::.||     
 Worm   632 GISGNLASAIFVPYYPTVGPSSAQCGVFSSVVVELWHFRHLLDPFELKFQSIAHLIVTLLVLCIG 696

  Fly   365 --------------------HILVFVSFDFGFAIY---ARYAGDE------LQLGSSSEFLAIDQ 400
                                .|:|:...|||...|   .:|....      :|.||.|..:.|..
 Worm   697 LIPWIDNWSHLFGTIFGLITSIIVYPYMDFGDKDYDPLLQYISSTVPKSPLVQRGSMSTIINIAD 761

  Fly   401 AETAGAVSYVAHL------AGAIAGLTIGLLVLKSFEQKLHEQLLWWIALGTYLALVVFAIAFNI 459
            ..||......|:.      .|.....| ..::.|...:|.:.:..:::    :::.:||:|..:|
 Worm   762 MRTAQGYGQWANAFPYRGDQGRTPVFT-AQVIWKFLRKKFNNKRSFYV----FISAIVFSILLSI 821

  Fly   460 MNGFAMFNIRVE 471
            :......|::::
 Worm   822 LLVVFFGNVKID 833

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stetNP_788450.1 EFh <75..115 CDD:298682
EF-hand_7 91..156 CDD:290234
Rhomboid 262..428 CDD:279958 50/215 (23%)
rom-3NP_503013.2 Rhomboid 582..725 CDD:366759 34/142 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.