Sequence 1: | NP_788450.1 | Gene: | stet / 38169 | FlyBaseID: | FBgn0020248 | Length: | 485 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_503013.2 | Gene: | rom-3 / 191000 | WormBaseID: | WBGene00004402 | Length: | 861 | Species: | Caenorhabditis elegans |
Alignment Length: | 272 | Identity: | 60/272 - (22%) |
---|---|---|---|
Similarity: | 114/272 - (41%) | Gaps: | 60/272 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 250 GPIPSDSMFIYRPDKRHEIWRFLFYMVLHAGWLHLGFNVAVQLVFGLPLEMVHGSTRIACIYFSG 314
Fly 315 VLAGSLGTSIFDPDVFLVGASG---GVYALLAA---HLANVL----LNYHQMRYGVIKLL----- 364
Fly 365 --------------------HILVFVSFDFGFAIY---ARYAGDE------LQLGSSSEFLAIDQ 400
Fly 401 AETAGAVSYVAHL------AGAIAGLTIGLLVLKSFEQKLHEQLLWWIALGTYLALVVFAIAFNI 459
Fly 460 MNGFAMFNIRVE 471 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
stet | NP_788450.1 | EFh | <75..115 | CDD:298682 | |
EF-hand_7 | 91..156 | CDD:290234 | |||
Rhomboid | 262..428 | CDD:279958 | 50/215 (23%) | ||
rom-3 | NP_503013.2 | Rhomboid | 582..725 | CDD:366759 | 34/142 (24%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0705 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1253228at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |