DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stet and RHBDL3

DIOPT Version :9

Sequence 1:NP_788450.1 Gene:stet / 38169 FlyBaseID:FBgn0020248 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001350764.1 Gene:RHBDL3 / 162494 HGNCID:16502 Length:428 Species:Homo sapiens


Alignment Length:245 Identity:105/245 - (42%)
Similarity:150/245 - (61%) Gaps:15/245 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 EAELRRELL-RDKWKLLFDMFDPEGFGEISVEEFLEALKSPEFLSQVPMNKRELLLERAKKAKLP 141
            |||.|.... .|.||:|||.|||...|.||..:|...|:|..  |::..:|||:||..|..    
Human    26 EAEERLPAAPEDHWKVLFDQFDPGNTGYISTGKFRSLLESHS--SKLDPHKREVLLALADS---- 84

  Fly   142 TGPGYVTFQDFVNVMSGKRTRSFKCAVHHRDREVCSENDFQLVLNEP--PLFRKMVHAVAMEILP 204
            ...|.:.:||||::||.||:.||:.|:...:|.:.|    :.:|.|.  .|.::::..||.|.||
Human    85 HADGQIGYQDFVSLMSNKRSNSFRQAILQGNRRLSS----KALLEEKGLSLSQRLIRHVAYETLP 145

  Fly   205 EERDRKYYADRYTCCPPPFFIILVTLVELGFFVYHSVVTGEAAPRGPIPS--DSMFIYRPDKRHE 267
            .|.|||:|.|.|||||||:|:|.|||:|:.||:|:.|..|:...:...|.  .:..:|.|..|.:
Human   146 REIDRKWYYDSYTCCPPPWFMITVTLLEVAFFLYNGVSLGQFVLQVTHPRYLKNSLVYHPQLRAQ 210

  Fly   268 IWRFLFYMVLHAGWLHLGFNVAVQLVFGLPLEMVHGSTRIACIYFSGVLA 317
            :||:|.|:.:|||..|||.||.:||:.|:|||||||:|||..:|.:||:|
Human   211 VWRYLTYIFMHAGIEHLGLNVVLQLLVGVPLEMVHGATRIGLVYVAGVVA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stetNP_788450.1 EFh <75..115 CDD:298682 17/37 (46%)
EF-hand_7 91..156 CDD:290234 25/64 (39%)
Rhomboid 262..428 CDD:279958 31/56 (55%)
RHBDL3NP_001350764.1 EF-hand_7 36..100 CDD:316058 27/69 (39%)
EF-hand motif 38..67 CDD:320054 14/28 (50%)
Rhomboid 205..>260 CDD:328780 30/54 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144494
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H34700
Inparanoid 1 1.050 280 1.000 Inparanoid score I2908
Isobase 1 0.950 - 0 Normalized mean entropy S5174
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 1 1.000 - - otm41807
orthoMCL 1 0.900 - - OOG6_109404
Panther 1 1.100 - - O PTHR45840
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2770
SonicParanoid 1 1.000 - - X2844
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.740

Return to query results.
Submit another query.