DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stet and rhbdl3

DIOPT Version :9

Sequence 1:NP_788450.1 Gene:stet / 38169 FlyBaseID:FBgn0020248 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_031750644.1 Gene:rhbdl3 / 101732375 -ID:- Length:350 Species:Xenopus tropicalis


Alignment Length:319 Identity:126/319 - (39%)
Similarity:191/319 - (59%) Gaps:41/319 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 MSGKRTRSFKCAV---HH--RDREVCSENDFQLVLNEPPLFRKMVHAVAMEILPEERDRKYYADR 215
            ||.||:.||:.|:   :|  |::.:..|:...|.       ::.:..:|.|.||.|.|||::.|.
 Frog    40 MSNKRSNSFRRAILQGNHQLRNKALLEESGLSLT-------QRFIRHMAYETLPREIDRKWFYDN 97

  Fly   216 YTCCPPPFFIILVTLVELGFFVYHSVVTGEAAPRGPIP---SDSMFIYRPDKRHEIWRFLFYMVL 277
            ||.||||:|||.||:||:..|||:.:|......:...|   .::..:|.|..|.:.||:|.||.:
 Frog    98 YTGCPPPWFIITVTIVEVAAFVYYGLVLDRFVLQATHPRYLRNNPLVYHPQVRVQAWRYLSYMFM 162

  Fly   278 HAGWLHLGFNVAVQLVFGLPLEMVHGSTRIACIYFSGVLAGSLGTSIFDPDVFLVGASGGVYALL 342
            |||..|||.|||:||:.|:|||||||:.||:.:|.:|:|||||..|:.|.....||||.||||||
 Frog   163 HAGIEHLGVNVALQLLVGVPLEMVHGAVRISFVYIAGILAGSLAVSVADTSAPAVGASAGVYALL 227

  Fly   343 AAHLANVLLNYHQMR--YGVIKLLHILVFVSFDFGFAIYAR-----YAGDELQLGSSSEFLAIDQ 400
            :|||||:::|:..|:  :.:::....|:.:||:||.|::.|     ||                 
 Frog   228 SAHLANIVMNWSGMKCQFKLLRTAFALICMSFEFGRAVWLRLYPSAYA----------------- 275

  Fly   401 AETAGAVSYVAHLAGAIAGLTIGLLVLKSFEQKLHEQLLWWIALGTYLALVVFAIAFNI 459
              .....|:||||.|.:.|:|:|::.|:::||:|.:|.|||:.|..|:..|.||:.:||
 Frog   276 --PCPHPSFVAHLGGVLVGITLGVITLRNYEQRLRDQSLWWVFLAIYVLFVTFAVLWNI 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stetNP_788450.1 EFh <75..115 CDD:298682
EF-hand_7 91..156 CDD:290234 126/319 (39%)
Rhomboid 262..428 CDD:279958 72/172 (42%)
rhbdl3XP_031750644.1 Rhomboid 152..301 CDD:396315 70/167 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I8135
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H34700
Inparanoid 1 1.050 248 1.000 Inparanoid score I3177
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 1 1.000 - - mtm9513
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2844
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.