DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stet and rhbdf1

DIOPT Version :9

Sequence 1:NP_788450.1 Gene:stet / 38169 FlyBaseID:FBgn0020248 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_004917997.1 Gene:rhbdf1 / 100494777 XenbaseID:XB-GENE-6083739 Length:892 Species:Xenopus tropicalis


Alignment Length:224 Identity:51/224 - (22%)
Similarity:89/224 - (39%) Gaps:57/224 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 PDKRHEIWRFLFYMVLHAGWLHLGFNVAVQLVFGLPLEMVHGSTRIACIYFSGVLAGSLGTSIFD 326
            ||:.:.:|..||   ||||.||...:|..|:.....||.:.|..||:.||....:.|:|.::||.
 Frog   687 PDQVYRLWLSLF---LHAGVLHCLVSVCFQMTILRDLEKLAGWHRISIIYILSGITGNLTSAIFL 748

  Fly   327 PDVFLVGASGGVYALLAAHLANVLLNYHQMR---YGVIKLLHILVFVSFDFGFAIYARYAGDELQ 388
            |....||.:|..:.:||.....:..::..:.   ....||..:::|: |.||...:         
 Frog   749 PYRAEVGPAGSQFGILACLFVELFQSWQILARPWRAFFKLFAVVIFL-FTFGLLPW--------- 803

  Fly   389 LGSSSEFLAIDQAETAGAVSYVAHLAGAIAGLTIGLLVLKSFEQKLHEQLLWWIALGTY------ 447
                              :...||.||.::|..:....|.            :|:.|.:      
 Frog   804 ------------------IDNFAHFAGFVSGFFLSFAFLP------------YISFGKFDMYRKR 838

  Fly   448 LALVVF-AIAFNIMNG----FAMFNIRVE 471
            ..:::| .|.|.:.:|    |.::.|:.|
 Frog   839 CQIIIFLLIFFGLFSGLVVLFYVYPIKCE 867

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stetNP_788450.1 EFh <75..115 CDD:298682
EF-hand_7 91..156 CDD:290234
Rhomboid 262..428 CDD:279958 41/168 (24%)
rhbdf1XP_004917997.1 Rhomboid_SP 127..345 CDD:372211
Rhomboid 687..827 CDD:366759 42/182 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.