DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stet and rhbdf2

DIOPT Version :9

Sequence 1:NP_788450.1 Gene:stet / 38169 FlyBaseID:FBgn0020248 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001090673.1 Gene:rhbdf2 / 100036646 XenbaseID:XB-GENE-966769 Length:826 Species:Xenopus tropicalis


Alignment Length:209 Identity:50/209 - (23%)
Similarity:89/209 - (42%) Gaps:42/209 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 PDKRHEIWRFLFYMVLHAGWLHLGFNVAVQLVFGLPLEMVHGSTRIACIYFSGVLAGSLGTSIFD 326
            ||:.:.:|..||   ||||.:|...:|..|:.....||.:.|..||:.||....:.|:|.:::|.
 Frog   621 PDQFYRLWLSLF---LHAGVIHCCVSVVFQMTVLRDLEKLAGWLRISIIYILSGITGNLASALFL 682

  Fly   327 PDVFLVGASGGVYALLAAHLANVLLNYHQMR---YGVIKLLHILVFVSFDFGFAIYARYAGDELQ 388
            |....||.:|..:.|||.....:..::..:.   ...:|||.|::|: |.||...:         
 Frog   683 PYRAEVGPAGSQFGLLACLFVELFQSWQILAKPWKAFLKLLGIVLFL-FLFGLLPW--------- 737

  Fly   389 LGSSSEFLAIDQAETAGAVSYVAHLAGAIAGLTIGLLVLK----SFEQKLHEQLLWWIAL----G 445
                              :..:||:.|.::||.:....|.    ....|..::.:..|:|    |
 Frog   738 ------------------IDNIAHIFGFLSGLLLSFSFLPYITFGTADKFRKRAMIIISLLVFVG 784

  Fly   446 TYLALVVFAIAFNI 459
            .:.:||::...:.|
 Frog   785 LFASLVIWLYVYPI 798

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stetNP_788450.1 EFh <75..115 CDD:298682
EF-hand_7 91..156 CDD:290234
Rhomboid 262..428 CDD:279958 42/168 (25%)
rhbdf2NP_001090673.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..78
Rhomboid_SP 90..287 CDD:372211
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..180
Rhomboid 620..761 CDD:366759 43/170 (25%)
MFS 746..>803 CDD:391944 11/53 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.