DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and RHBDL1

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_024306253.1 Gene:RHBDL1 / 9028 HGNCID:10007 Length:526 Species:Homo sapiens


Alignment Length:208 Identity:57/208 - (27%)
Similarity:90/208 - (43%) Gaps:53/208 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SQEEEHATAAKETIIDIPAACSSSSNSSSYDTDCSTASSTCCTRQGEHIYMQREAIPAT-PLPES 87
            :|..|......:.::|:    .||..|||:....:..               :.|:|.. ||.| 
Human   116 AQSNEQGQVCYQELVDL----ISSKRSSSFKRAIANG---------------QRALPRDGPLDE- 160

  Fly    88 EDIGLLK---------------------YVHRQ-HWPWFILVISIIEIAIF-----AYDRYTMPA 125
            ..:|:.|                     |.||. ..|.|:..:::.:|.:|     ..:::.:..
Human   161 PGLGVYKRFVRYVAYEILPCEVDRRWYFYRHRSCPPPVFMASVTLAQIIVFLCYGARLNKWVLQT 225

  Fly   126 QNFGLPVPIPSDSVLVYRPDRRLQVWRFFSYMFLHANWFHLGFNIVIQLFFGIPLEVMHGTARIG 190
            .:     |....|.|||.|..|.:.|||.:|||:|.....||||.::||..|:|||::||..||.
Human   226 YH-----PEYMKSPLVYHPGHRARAWRFLTYMFMHVGLEQLGFNALLQLMIGVPLEMVHGLLRIS 285

  Fly   191 VIYMAGVFAGSLG 203
            ::|:|||.||..|
Human   286 LLYLAGVLAGEAG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 30/60 (50%)
RHBDL1XP_024306253.1 Rhomboid 239..>295 CDD:328780 27/55 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4469
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.