DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and PCP1

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_011615.1 Gene:PCP1 / 852993 SGDID:S000003333 Length:346 Species:Saccharomyces cerevisiae


Alignment Length:258 Identity:53/258 - (20%)
Similarity:82/258 - (31%) Gaps:117/258 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 QHWPWFI--------LVISIIEIAIFAYDRYTMPAQNFGLPVPIPSDSVLVYRPDRRLQVWRFF- 154
            :|.|.|.        ||.:::.|.:..:..:.:|                        :.|||. 
Yeast   130 EHVPPFTYFKTHPKNLVYALLGINVAVFGLWQLP------------------------KCWRFLQ 170

  Fly   155 SYM-----------------FLHANWFHLGFNIVIQLFFGIPLEVMHGTARIGVIYMAGVFAGSL 202
            .||                 |.|..::|||.|::....||..|..|.|.:....:||....||||
Yeast   171 KYMLLQKDYVTSKISIIGSAFSHQEFWHLGMNMLALWSFGTSLATMLGASNFFSLYMNSAIAGSL 235

  Fly   203 GT---------SVVDSEVFLVGASGGVYALL------------------------AAHLANITLN 234
            .:         ::|...   :||||.::.:|                        .|.||::..|
Yeast   236 FSLWYPKLARLAIVGPS---LGASGALFGVLGCFSYLFPHAKILLFVFPVPGGAWVAFLASVAWN 297

  Fly   235 YAHMKSASTQLGSVVIFVSCDLGYALYTQYFDGSAFAKGPQVSYIAHLTGALAGLTIGFLVLK 297
            .|                    |.||....||           |.|||.|::.|:..|:.:.|
Yeast   298 AA--------------------GCALRWGSFD-----------YAAHLGGSMMGVLYGWYISK 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 45/203 (22%)
PCP1NP_011615.1 Rhomboid 186..329 CDD:396315 40/176 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.