DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and RBL2

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_176500.1 Gene:RBL2 / 842616 AraportID:AT1G63120 Length:317 Species:Arabidopsis thaliana


Alignment Length:295 Identity:77/295 - (26%)
Similarity:122/295 - (41%) Gaps:71/295 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 HW-PWFILVISIIEIAIF--------AYDRYTMP-----AQNFGL---------PVPIPSDSVL- 140
            || .|.|..|.:..:|:|        ...:.|.|     |:..|.         |:..||.|.| 
plant    30 HWTSWLIPAIVVANLAVFIAVMFVNDCPKKITGPNKECVARFLGRFSFQPLKENPLFGPSSSTLE 94

  Fly   141 ----------VYRPDRRLQVWRFFSYMFLHANWFHLGFNIVIQLFFGIPLEVMHGTARIGVIYMA 195
                      |:..    |.||..|.|:|||...||..|::..:|.||.||...|..|:|:||:.
plant    95 KMGALEWRKVVHEH----QGWRLLSCMWLHAGIIHLLTNMLSLIFIGIRLEQQFGFIRVGLIYLI 155

  Fly   196 GVFAGSLGTSVVDSEVFLVGASGGVYALLAAHLANITLNYAHMKSASTQLGSVVIFVSCDLGYAL 260
            ....||:.:|:...|...|||||.::.||.|.|:.:..|:....:.:..|.:::..::.:|...:
plant   156 SGLGGSILSSLFLQESISVGASGALFGLLGAMLSELLTNWTIYANKAAALITLLFIIAINLALGM 220

  Fly   261 YTQYFDGSAFAKGPQVSYIAHLTGALAGLTIGF--LVLKNFG-----------HREYEQLIWWLA 312
            .            |:|...||:.|.|.|..:||  ||...:|           .|:|       :
plant   221 L------------PRVDNFAHIGGFLTGFCLGFVLLVRPQYGWEASRTNTSRTKRKY-------S 266

  Fly   313 LGVYCAFTVFAIVFNLINTVTAQLMEEQGEVITQH 347
            :..|..|.| ::|..::....|.:|..:||...:|
plant   267 MYQYVLFVV-SVVLLVVGLTVALVMLFKGENGNKH 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 48/154 (31%)
RBL2NP_176500.1 Rhomboid 105..244 CDD:279958 47/154 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1037
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.