DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and RBL5

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_175667.1 Gene:RBL5 / 841690 AraportID:AT1G52580 Length:309 Species:Arabidopsis thaliana


Alignment Length:282 Identity:68/282 - (24%)
Similarity:112/282 - (39%) Gaps:77/282 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 RQHW------PWFILVISIIEIAIFAYDRYTMPAQNFGLPVPIPSDSVLV--------YRP---- 144
            |.|:      ||...::.:|..|.|.....||...:    .|..||..|:        ::|    
plant    20 RPHFRPPIPVPWVAWLVPLILAANFVTFATTMYVND----CPARSDECLLFDVLGRLSFQPIKEN 80

  Fly   145 ----------------DRRL----QVWRFFSYMFLHANWFHLGFNIVIQLFFGIPLEVMHGTARI 189
                            :|||    :.||..|.::||..:.||..|::..:..|:.||...|..||
plant    81 MLLGPSIPTLRKLGALERRLVEEGERWRLISCIWLHGGFLHLMANMISLMCIGMRLEQEFGFMRI 145

  Fly   190 GVIYMAGVFAGSLGTSVVDS--EVFLVGASGGVYALLAAHLANITLNYAHMKSASTQLGSVVIFV 252
            |.:|:.....|||.:.:.||  |...|||||.::.||.|.|:.:..|:...::..|.|.::::.:
plant   146 GALYVISGLGGSLVSCLTDSQGERVSVGASGALFGLLGAMLSELITNWTIYENKCTALMTLILII 210

  Fly   253 SCDLGYALYTQYFDGSAFAKGPQVSYIAHLTGALAGLTIGFLVL--------------------- 296
            ..:|.....            |:|...||..|.|||..:||::|                     
plant   211 VLNLSVGFL------------PRVDNSAHFGGFLAGFFLGFVLLLRPQYGYVNPKYIPPGYDMKH 263

  Fly   297 KNFGHREYEQLIWWLALGVYCA 318
            |...|:.|:.:..:.:|.:..|
plant   264 KKSKHKCYQHIFRFTSLAILLA 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 50/199 (25%)
RBL5NP_175667.1 Rhomboid 104..246 CDD:366759 46/153 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1037
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.