DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and RBL12

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_564058.1 Gene:RBL12 / 838441 AraportID:AT1G18600 Length:336 Species:Arabidopsis thaliana


Alignment Length:195 Identity:37/195 - (18%)
Similarity:61/195 - (31%) Gaps:83/195 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 VWRFFSYMFLHANWF-------------------------HLGFNIVIQLFFGIPLEVMHGTARI 189
            :||.|:..|:..|:.                         |:..|::...|||..:....|...:
plant   149 MWRVFNQQFMMNNFMISLDNFKSGRLHTLITSAFSHIDIGHIVSNMIGLYFFGTSIARNFGPQFL 213

  Fly   190 GVIYMAGVFAGSL----------GTSVVDSEVFL--------VGASGGVYALLAAHLANITLNYA 236
            ..:|:||...||:          .||......|:        :||||.|.|::...:      :.
plant   214 LKLYLAGALGGSVFYLIHHAYMAATSPKGQGAFVRDPSRTPGLGASGAVNAIMLLDI------FL 272

  Fly   237 HMKSASTQLGSVVIFVSCDLGYALYTQYF---------------DGSAFAKG-PQVSYIAHLTGA 285
            |.::                  .||.::|               |.....:| ..:|..|||.||
plant   273 HPRA------------------TLYLEFFIPVPAMLLGIFLIGKDILRITEGNSNISGSAHLGGA 319

  Fly   286  285
            plant   320  319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 37/195 (19%)
RBL12NP_564058.1 Rhomboid 170..318 CDD:396315 30/171 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.