DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and RBL6

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001184975.1 Gene:RBL6 / 837831 AraportID:AT1G12750 Length:307 Species:Arabidopsis thaliana


Alignment Length:235 Identity:65/235 - (27%)
Similarity:95/235 - (40%) Gaps:50/235 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 HR---QHWPWFILVISIIEIAIFAYDRYT--MPAQNFGL--------------------PVPIPS 136
            ||   |...|....|.:..::||....||  .|....|.                    |...||
plant    12 HRGDTQWTAWLTPTIVVANVSIFIVVMYTNDCPKTTTGANGDCVAKLLRRFSFQPLRENPFLGPS 76

  Fly   137 DSVL----------VYRPDRRLQVWRFFSYMFLHANWFHLGFNIVIQLFFGIPLEVMHGTARIGV 191
            .|.|          |.:.:.:   ||..:.|:|||...||..|:...:.|||.||...|..|||:
plant    77 SSTLEKLGALDWKKVVQGNEK---WRLITAMWLHAGIIHLVMNMFDVIIFGIRLEQQFGFIRIGL 138

  Fly   192 IYMAGVFAGSLGTSVVDSEVFLVGASGGVYALLAAHLANITLNYAHMKSASTQLGSVVIFVSCDL 256
            ||:...|.||:.:::...:...|||||.:..|:.|.|:.:..|:...||....|.|.:..::.:|
plant   139 IYLISGFGGSILSALFLQKSISVGASGALLGLMGAMLSELLTNWTIYKSKLCALLSFLFIIAINL 203

  Fly   257 GYALYTQYFDGSAFAKGPQVSYIAHLTGALAGLTIGFLVL 296
            ...|.            |.|...||:.|.|.|..:||::|
plant   204 AIGLL------------PWVDNFAHIGGLLTGFCLGFILL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 48/153 (31%)
RBL6NP_001184975.1 Rhomboid 92..232 CDD:279958 48/155 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1037
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.