DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and AT5G38510

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001078681.1 Gene:AT5G38510 / 833839 AraportID:AT5G38510 Length:434 Species:Arabidopsis thaliana


Alignment Length:208 Identity:51/208 - (24%)
Similarity:85/208 - (40%) Gaps:37/208 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 WRFFSYMFLHANWFHLGFNIVIQLFFGIPLEVMHGTARIGVIYMAGVFAGSLGTSVVDSEVFLVG 215
            ||..:.||||:...|:..:....|.||..:...:|.....:||:.|..:|:. .|.:.:....||
plant   232 WRLVTPMFLHSGIPHVALSSWALLTFGPKVCRDYGLFTFCLIYILGGVSGNF-MSFLHTADPTVG 295

  Fly   216 ASGGVYALLAAHLANITLNYAHMKSASTQ-LGSVVIFVSCDLGYALYTQYFDGSAFAKGPQVSYI 279
            .:|..:||:.|.|.:...|...:||...: |....|.::   |:.|...:|       || :...
plant   296 GTGPAFALIGAWLVDQNQNKEMIKSNEYEDLFQKAIIMT---GFGLILSHF-------GP-IDDW 349

  Fly   280 AHLTGALAGLTIGF-----LVLKNFGHREYEQLIWWLALG-----------VYCAFTVFAIVFNL 328
            .:|...:||:..||     |.|.:.|....|.::   .:|           .:..||:|..|.  
plant   350 TNLGALIAGIVYGFFTCPVLQLGSGGSERQEGIV---TVGPEKQNSADPCKSFLLFTIFVAVI-- 409

  Fly   329 INTVTAQLMEEQG 341
               ||:.|:...|
plant   410 ---VTSLLLIGDG 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 39/151 (26%)
AT5G38510NP_001078681.1 Rhomboid 225..367 CDD:396315 38/146 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.