DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and AT5G25640

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001318651.1 Gene:AT5G25640 / 832640 AraportID:AT5G25640 Length:287 Species:Arabidopsis thaliana


Alignment Length:215 Identity:57/215 - (26%)
Similarity:88/215 - (40%) Gaps:45/215 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 ILVISIIEIAIFAYDRYTMPAQNF----GL-PVPIPSDSVLVYRPDRRLQVW-RFFSYMFLHANW 163
            |.:|.:|.:|||.       ||:|    |: .:.:.||          ..|| :|.:..|.||||
plant    91 IFLIILINLAIFI-------AQHFYQVRGIKSMYLSSD----------FPVWYQFVTATFCHANW 138

  Fly   164 FHLGFNIVIQLFFGIPLEVMHGTARIGVIYM-AGVFAGSLGTSVVDSEVFLVGASGGVYALLAAH 227
            .||..|:.:...||..:|...|...:.:.|: .||.|..:....:....|..||||.|:.|....
plant   139 NHLSSNLFLLYIFGKIVEEEKGNFGLWLSYLFTGVGANMVSWFTLPPNSFFSGASGAVFGLFVIS 203

  Fly   228 LANITLNYAHMKSASTQLGSVVI---FVSCDLGYALYTQ-----------YFDGSAFAKGPQ-VS 277
            :      ...|....::...|:|   ||...:..|:.|.           .|.|:.|....| |.
plant   204 V------LVKMSRGWSKFLEVLILGQFVMKRVSEAVQTSTGLLETKFCGFIFGGNEFLTIIQTVR 262

  Fly   278 YIAHLTGALAGLTIGFLVLK 297
            .:|..:|||.|:.:.:|:.|
plant   263 PVAQFSGALLGVLLVWLLSK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 44/169 (26%)
AT5G25640NP_001318651.1 Rhomboid 125..>221 CDD:419717 27/101 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I2672
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.