DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and RBL3

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_196342.1 Gene:RBL3 / 830616 AraportID:AT5G07250 Length:346 Species:Arabidopsis thaliana


Alignment Length:331 Identity:74/331 - (22%)
Similarity:120/331 - (36%) Gaps:89/331 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 REAIPATPLP----ESEDIGLLKYVHRQHW-PWFILVISIIEIAIFAYDRYTMPAQN-------- 127
            |..|...|||    .|.:.|  .......| .|.:.:..:..:|:|....:.....|        
plant    26 RNRIGPPPLPVALSSSTEFG--DNALSSRWTSWLVPMFVVANVAVFVVAMFVNNCPNHFESHRLR 88

  Fly   128 ---------------------FGLPVPIPSDSVLV-------YRPDRRLQVWRFFSYMFLHANWF 164
                                 ||     ||...|.       .:...:.:.||..:.::|||...
plant    89 GHCVAKFLGRLSFEPLRTNPLFG-----PSSHTLEKLGALEWSKVVEKKEGWRLLTCIWLHAGVI 148

  Fly   165 HLGFNIVIQLFFGIPLEVMHGTARIGVIYMAGVFAGSLGTSVVDSEVFLVGASGGVYALLAAHLA 229
            |||.|::..:|.||.||...|..||||||:.....||:.:|:.......|||||.::.||.:.|:
plant   149 HLGANMLSLVFIGIRLEQQFGFVRIGVIYLLSGIGGSVLSSLFIRNSISVGASGALFGLLGSMLS 213

  Fly   230 NITLNYAHMKSASTQLGSVVIFVSCDLGYALYTQYFDGSAFAKGPQVSYIAHLTGALAGLTIGFL 294
            .:..|:....:....|.:::..:..:|...:.            |.|...||:.|.:.|..:||:
plant   214 ELFTNWTIYSNKIAALLTLLFVILINLAIGIL------------PHVDNFAHVGGFVTGFLLGFI 266

  Fly   295 VLK------------------NFGHREYEQLIWWLALGVYCAFTVFAIVFNLINTVTAQLMEEQG 341
            :|.                  .:.::.|:.|:|.|:|           |..:...|.|.||..:|
plant   267 LLARPQFKWLAREHMPQGTPLRYKYKTYQYLLWLLSL-----------VLLIAGFVVALLMLFRG 320

  Fly   342 EVITQH 347
            |....|
plant   321 ENGNDH 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 43/152 (28%)
RBL3NP_196342.1 Rhomboid 128..269 CDD:396315 43/152 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1037
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X418
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.780

Return to query results.
Submit another query.