DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and RBL15

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001190126.1 Gene:RBL15 / 825015 AraportID:AT3G58460 Length:426 Species:Arabidopsis thaliana


Alignment Length:187 Identity:43/187 - (22%)
Similarity:69/187 - (36%) Gaps:59/187 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 RLQVWRFFSYMFLHANWFHLGFNIVIQLFFGIPLEVMHGTARIGVIYMAGVFAGSLGTSVVDSEV 211
            |.||:||::.:..|.:..|:.||::..:..|..||.:.|:.|:  :|:                .
plant    84 RFQVYRFYTAIIFHGSLLHVLFNMMALVPMGSELERIMGSVRL--LYL----------------T 130

  Fly   212 FLVGASGGVYALLAAHLA--NITLNYAHMKSASTQLGSVVIFVSCDLGYALYTQYFDGSAFAKGP 274
            .|:..:..|..||.|.||  |....|.|:.:            .|.:|       |.|..|:   
plant   131 VLLATTNAVLHLLIASLAGYNPFYQYDHLMN------------ECAIG-------FSGILFS--- 173

  Fly   275 QVSYIAHLTGALAGLTIGFLVLKNFGHREYEQLIWWLALGVYCAFTVFAIVFNLINT 331
            .:.....|:|..:....|   |.|...:.|.    |:.|          |||.|:.|
plant   174 MIVIETSLSGVTSRSVFG---LFNVPAKLYP----WILL----------IVFQLLMT 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 33/151 (22%)
RBL15NP_001190126.1 Rhomboid 81..235 CDD:279958 43/187 (23%)
UBA_At3g58460_like 387..422 CDD:270473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.