DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and RBL14

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_850606.1 Gene:RBL14 / 821028 AraportID:AT3G17611 Length:334 Species:Arabidopsis thaliana


Alignment Length:241 Identity:61/241 - (25%)
Similarity:82/241 - (34%) Gaps:96/241 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 YTMPAQNFGLPVPIPSDSVLVYRPD---RRLQVWRFFSYMFLHANWFHLGFNIVIQLFFGIPLEV 182
            |..||  |..|| ||..|.:.:.|.   :...:.|.|...|.|.|..||.:|::..|:.||.||.
plant    47 YLRPA--FIDPV-IPHISEVWFNPHLIFKHKDLKRLFLSAFYHVNEPHLVYNMMSLLWKGIKLET 108

  Fly   183 MHGTARIGVIYMAGVFAGSLGTSVVDSEVF-LVGASGGVYALLAAHLANITLNYAHMKSASTQLG 246
                              |:|:|...|.|| |:|.|.||..|||..|                  
plant   109 ------------------SMGSSEFASMVFTLIGMSQGVTLLLAKSL------------------ 137

  Fly   247 SVVIFVSCDLGYALYTQY---FDGSAFAKG----------------------------------- 273
             :::|   |...|.|.:|   |.|..||..                                   
plant   138 -LLLF---DYDRAYYNEYAVGFSGVLFAMKVVLNSQAEDYSSVYGILVPTKYAAWAELILVQMFV 198

  Fly   274 PQVSYIAHLTGALAGLTIGFLVLK---------NFGHREYEQLIWW 310
            |..|::.||.|.|||:.  :|.||         ....|...:|:.|
plant   199 PNASFLGHLGGILAGII--YLKLKGSYSGSDPVTMAVRGVSRLVTW 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 47/194 (24%)
RBL14NP_850606.1 Rhomboid 78..216 CDD:419717 45/179 (25%)
zf-RanBP 274..298 CDD:395516
RanBP2-type Zn finger 277..296 CDD:275376
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.