DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and rhbdf1a

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_005164392.1 Gene:rhbdf1a / 798402 ZFINID:ZDB-GENE-040704-75 Length:893 Species:Danio rerio


Alignment Length:309 Identity:66/309 - (21%)
Similarity:111/309 - (35%) Gaps:104/309 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SSSSNSSSYDTDCSTASSTCC--TRQGEHI-----------YMQREAIPATPLPESEDI-GLLKY 95
            :|.::::....||:.....||  |:....|           |...||...:.:...:|: |||.:
Zfish   618 NSGNHTNLPHIDCTITGRPCCIGTKGRCEITSREYCDFMKGYFHEEATLCSQVHCMDDVCGLLPF 682

  Fly    96 VHRQHWPWFILVISIIEIAIFAYDRYTMPAQNFGLPVPIPSDSVLVYRPDRRLQVWRFFSYMFLH 160
            ::.:                                           .||   |.:|.:..:|||
Zfish   683 LNPE-------------------------------------------VPD---QFYRLWLSLFLH 701

  Fly   161 ANWFHLGFNIVIQLFFGIPLEVMHGTARIGVIYMAGVFAGSLGTSVVDSEVFL-----VGASGGV 220
            |...|...::..|:.....||.:.|..||.:||:.....|:|.     |.:||     ||.:|..
Zfish   702 AGILHCLVSVCFQMTILRDLEKLAGWLRISIIYILSGITGNLA-----SAIFLPYRAEVGPAGSQ 761

  Fly   221 YALLAAHLANITLNY---AHMKSASTQLGSVVIFVSCDLGYALYTQYFDGSAFAKGPQVSYIAHL 282
            :.:||.....:..::   |....|.|:|..||:|:               .||...|.:...||:
Zfish   762 FGILACLFVELIQSWQILAQPWRAFTKLLCVVLFL---------------FAFGLLPWIDNFAHI 811

  Fly   283 TGALAG--LTIGFLVLKNFGHREYEQLIWWLALGVY---CAFTVFAIVF 326
            :|.::|  |:..||...:||.           |.:|   |...:|.:||
Zfish   812 SGFISGFFLSFAFLPYISFGR-----------LDMYRKRCQIIIFLVVF 849

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 44/162 (27%)
rhbdf1aXP_005164392.1 Rhomboid_SP 130..347 CDD:289371
Rhomboid 685..826 CDD:279958 43/206 (21%)
DUF805 <792..864 CDD:294752 21/84 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.