DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and RHBDF2

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_078875.4 Gene:RHBDF2 / 79651 HGNCID:20788 Length:856 Species:Homo sapiens


Alignment Length:364 Identity:81/364 - (22%)
Similarity:131/364 - (35%) Gaps:122/364 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KVDLGQEKEKEASQEEEHATAAKETIIDIPAA---------------CSS---SSNSSSYDTDCS 58
            |.||||::...|...::..|..:      ||:               |:.   |:::.....||.
Human   536 KSDLGQKRTSGAVCHQDPRTCEE------PASSGAHIWPDDITKWPICTEQARSNHTGFLHMDCE 594

  Fly    59 TASSTCC----------TR---QGEHIYMQREAIPATPLPESEDIGLLKYVHRQHWPWFILVISI 110
            .....||          ||   :..|.|...||.            |...||             
Human   595 IKGRPCCIGTKGSCEITTREYCEFMHGYFHEEAT------------LCSQVH------------- 634

  Fly   111 IEIAIFAYDRYTMPAQNFGLPVPIPSDSVLVYRPDRRLQVWRFFSYMFLHANWFHLGFNIVIQLF 175
                  ..|:..      || :|..:..|    ||   |.:|.:..:||||...|...::|.|:.
Human   635 ------CLDKVC------GL-LPFLNPEV----PD---QFYRLWLSLFLHAGVVHCLVSVVFQMT 679

  Fly   176 FGIPLEVMHGTARIGVIYMAGVFAGSLGTSVVDSEVFL-----VGASGGVYALLAAHLANITLNY 235
            ....||.:.|..||.:|::.....|:|.     |.:||     ||.:|..:.|||.....:..::
Human   680 ILRDLEKLAGWHRIAIIFILSGITGNLA-----SAIFLPYRAEVGPAGSQFGLLACLFVELFQSW 739

  Fly   236 AHMK---SASTQLGSVVIFVSCDLGYALYTQYFDGSAFAKG--PQVSYIAHLTGALAGLTIGFLV 295
            ..::   .|...|.::|:|:                 |..|  |.:..|||:.|.|:||.:.|..
Human   740 PLLERPWKAFLNLSAIVLFL-----------------FICGLLPWIDNIAHIFGFLSGLLLAFAF 787

  Fly   296 LK--NFGHRE-YEQ----LIWWLAL-GVYCAFTVFAIVF 326
            |.  .||..: |.:    |:..||. |::.|..::..::
Human   788 LPYITFGTSDKYRKRALILVSLLAFAGLFAALVLWLYIY 826

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 43/162 (27%)
RHBDF2NP_078875.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115
Rhomboid_SP 128..334 CDD:289371
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..184
Involved in interaction with FRMD8. /evidence=ECO:0000269|PubMed:29897333 191..271
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 531..553 6/16 (38%)
Rhomboid 648..789 CDD:279958 44/169 (26%)
GtrA 748..832 CDD:303012 24/96 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.