DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and parl

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_021322181.1 Gene:parl / 792889 -ID:- Length:361 Species:Danio rerio


Alignment Length:223 Identity:56/223 - (25%)
Similarity:89/223 - (39%) Gaps:57/223 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 VISIIEIAIFAYDRYTMPAQNFGLPVPIPSDSVLVYRPDRRLQVWRFFSYMFLHANWFHLGFNIV 171
            |..||.:..|.:..:.:|:....:.....|:      |..:...|......|.|.:.|||..|:.
Zfish   150 VTGIIAVNAFVFCCWRVPSLQHLMVKYFTSN------PSSKALCWPMLLSTFSHYSLFHLSANMY 208

  Fly   172 IQLFFGIPLEVMHGTARIGVIYMA-GVFA-----------GSLGTSVVDSEVFLVGASGGVYALL 224
            :...|...:..|.|..:...:|:: ||.:           |.||.|        :||||.:.|:|
Zfish   209 VLWSFSSSIINMMGKEQFMALYLSTGVISTFVSYVSKTAMGRLGPS--------LGASGAIMAVL 265

  Fly   225 A--------AHLANITLNYAHMKSASTQLGSVVIFVSCDLGYALYTQYFDGSAFAKGPQVSYIAH 281
            |        |.||.|.|. .:..:|...|.::|...:  .|..|..::||           :.||
Zfish   266 AAVCTKMPEAKLAIIFLP-MYTFTAGNALKAIVALDT--TGLILGWRFFD-----------HAAH 316

  Fly   282 LTGALAGLTIGFLVLKNFGHREYEQLIW 309
            |.|||.|  |.:::   :||    :|||
Zfish   317 LGGALFG--IWYII---YGH----ELIW 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 45/172 (26%)
parlXP_021322181.1 Rhomboid 188..335 CDD:307698 47/177 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.