DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and rhbdl2

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_957498.1 Gene:rhbdl2 / 792002 ZFINID:ZDB-GENE-040426-732 Length:294 Species:Danio rerio


Alignment Length:235 Identity:91/235 - (38%)
Similarity:142/235 - (60%) Gaps:17/235 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 PWFILVISIIEIAIFAYDRYTMPAQNF---GLPVPIPSDSVLVYRPDRRLQVWRFFSYMFLHANW 163
            |.||::||:.|:|:|.|.....|.:.:   |..:   .||.|.|||::|.:.|||.||||:||..
Zfish    62 PIFIILISLAELAVFIYYAVWKPQKQWITLGTGI---WDSPLTYRPEQRKEAWRFVSYMFVHAGV 123

  Fly   164 FHLGFNIVIQLFFGIPLEVMHGTARIGVIYMAGVFAGSLGTSVVDSEVFLVGASGGVYALLAAHL 228
            .|:..|:::||..|||||::|....:|::||.||.||||.:|:.|....|||||||||||:..:.
Zfish   124 EHIMGNLLMQLLLGIPLELVHKGFEVGMVYMCGVLAGSLASSIFDPFSALVGASGGVYALMGGYF 188

  Fly   229 ANITLNYAHMKSASTQLG-----SVVIFVSCDLGYALYTQYFDGSAFAKGPQVSYIAHLTGALAG 288
            .|..:|:..|:   ..||     .:|:.|..|:|:|||.::....|   |.:||::||:.|.:||
Zfish   189 MNAIVNFREMR---VLLGVFRILVIVLIVGTDVGFALYRRFIVHEA---GLKVSFVAHIGGGIAG 247

  Fly   289 LTIGFLVLKNFGHREYEQLIWWLALGVYCAFTVFAIVFNL 328
            :|||::...|:.....:...:|:.:..|..|.:||::||:
Zfish   248 MTIGYVFFTNYNKELLKDPRFWMCIVGYIVFLLFAVIFNI 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 67/157 (43%)
rhbdl2NP_957498.1 Rhomboid 104..255 CDD:279958 67/156 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107191
Panther 1 1.100 - - O PTHR45840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.