DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and rhbdf1b

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_021328201.1 Gene:rhbdf1b / 563403 ZFINID:ZDB-GENE-130531-6 Length:894 Species:Danio rerio


Alignment Length:199 Identity:54/199 - (27%)
Similarity:88/199 - (44%) Gaps:39/199 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 PDRRLQVWRFFSYMFLHANWFHLGFNIVIQLFFGIPLEVMHGTARIGVIYMAGVFAGSLGTSVVD 208
            ||   |.:|.:..:||||...|...::..|:.....||.:.|..||.:||:.....|:|.     
Zfish   689 PD---QFYRLWLSLFLHAGILHCLVSVCFQMTILRDLEKLAGWLRISIIYILSGITGNLA----- 745

  Fly   209 SEVFL-----VGASGGVYALLAAHLANITLNY---AHMKSASTQLGSVVIFVSCDLGYALYTQYF 265
            |.:||     ||.:|..:.:||.....:..::   |....|.|:|..||:|:             
Zfish   746 SAIFLPYRAEVGPAGSQFGILACLFVELFQSWQILARPWRAFTKLSCVVLFL------------- 797

  Fly   266 DGSAFAKGPQVSYIAHLTGALAG--LTIGFLVLKNFG----HREYEQLIWWLAL--GVYCAFTVF 322
              .||...|.:...||:.|.::|  |:..||...:||    :|:..|::..|.|  |::.:|.|.
Zfish   798 --FAFGLLPWIDNFAHICGFVSGFFLSFAFLPYISFGRMDMYRKRLQILVALTLFVGIFSSFVVL 860

  Fly   323 AIVF 326
            ..|:
Zfish   861 FYVY 864

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 44/162 (27%)
rhbdf1bXP_021328201.1 Rhomboid_SP 130..348 CDD:315299
Rhomboid 686..829 CDD:307698 44/162 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.