Sequence 1: | NP_001261255.1 | Gene: | rho / 38168 | FlyBaseID: | FBgn0004635 | Length: | 355 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021328201.1 | Gene: | rhbdf1b / 563403 | ZFINID: | ZDB-GENE-130531-6 | Length: | 894 | Species: | Danio rerio |
Alignment Length: | 199 | Identity: | 54/199 - (27%) |
---|---|---|---|
Similarity: | 88/199 - (44%) | Gaps: | 39/199 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 144 PDRRLQVWRFFSYMFLHANWFHLGFNIVIQLFFGIPLEVMHGTARIGVIYMAGVFAGSLGTSVVD 208
Fly 209 SEVFL-----VGASGGVYALLAAHLANITLNY---AHMKSASTQLGSVVIFVSCDLGYALYTQYF 265
Fly 266 DGSAFAKGPQVSYIAHLTGALAG--LTIGFLVLKNFG----HREYEQLIWWLAL--GVYCAFTVF 322
Fly 323 AIVF 326 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rho | NP_001261255.1 | Rhomboid | 144..297 | CDD:279958 | 44/162 (27%) |
rhbdf1b | XP_021328201.1 | Rhomboid_SP | 130..348 | CDD:315299 | |
Rhomboid | 686..829 | CDD:307698 | 44/162 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1253228at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X418 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.920 |