DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and rhbdl3

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_005166241.1 Gene:rhbdl3 / 550128 ZFINID:ZDB-GENE-050417-2 Length:407 Species:Danio rerio


Alignment Length:235 Identity:92/235 - (39%)
Similarity:142/235 - (60%) Gaps:15/235 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 PWFILVISIIEIAIFAY-----DRYTMPAQN-FGLPVPIPSDSVLVYRPDRRLQVWRFFSYMFLH 160
            ||.:|.|:|.|:.:|.|     :|:.:...: :.|..|:|      |.|..|.|.|||.||:|:|
Zfish   166 PWLMLAITITEVVVFMYYGLQLNRWVLQVSSPYFLKGPLP------YHPQLRAQAWRFLSYIFMH 224

  Fly   161 ANWFHLGFNIVIQLFFGIPLEVMHGTARIGVIYMAGVFAGSLGTSVVDSEVFLVGASGGVYALLA 225
            |...|||.|:.:||..|:|||::||..|||::|:.|..||||..||.|....:||:|||||||::
Zfish   225 AGIEHLGLNMAMQLLVGVPLEMVHGALRIGLVYVCGALAGSLAVSVTDMTAPVVGSSGGVYALVS 289

  Fly   226 AHLANITLNYAHMKSAST--QLGSVVIFVSCDLGYALYTQYFDGSAFAKGPQVSYIAHLTGALAG 288
            |||||:.:|::.||....  ::...::.:|.:.|.|::.:.:. .||...|..|::|||.|...|
Zfish   290 AHLANVVMNWSGMKCQFKLFRMAMALVCMSVEFGRAVWLRCYP-PAFPPCPNPSFVAHLGGVAVG 353

  Fly   289 LTIGFLVLKNFGHREYEQLIWWLALGVYCAFTVFAIVFNL 328
            ||:|.:||:|:..|..||.::|:...||..|.:..|.:|:
Zfish   354 LTLGVVVLQNYEQRLQEQSLFWIFFSVYTLFILCGIFWNI 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 68/154 (44%)
rhbdl3XP_005166241.1 EFh 35..95 CDD:238008
EF-hand_7 35..94 CDD:290234
Rhomboid 208..362 CDD:279958 68/154 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577612
Domainoid 1 1.000 148 1.000 Domainoid score I4412
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 1 1.000 - - mtm6530
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.950

Return to query results.
Submit another query.