DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and RHBDL2

DIOPT Version :10

Sequence 1:NP_523883.2 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001291675.1 Gene:RHBDL2 / 54933 HGNCID:16083 Length:383 Species:Homo sapiens


Alignment Length:79 Identity:15/79 - (18%)
Similarity:30/79 - (37%) Gaps:11/79 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QEEAFNGKPAKIARSHGRNFRSRSRRKPLG-----------YCRVSETQVIEPDANKACKKLPNI 57
            :::..:|||..::...|.......:||.|.           ...|:||::......|.......:
Human    76 EDKTGSGKPPTVSHRLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSWGVYTKESLCSFAL 140

  Fly    58 KCIVEVLLKWLEGM 71
            ||::.:....|.|:
Human   141 KCLISLSTVILLGL 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_523883.2 Rhomboid 144..297 CDD:426384
RHBDL2NP_001291675.1 Rhomboid 194..346 CDD:426384
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.