DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and RHBDL2

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001291675.1 Gene:RHBDL2 / 54933 HGNCID:16083 Length:383 Species:Homo sapiens


Alignment Length:266 Identity:94/266 - (35%)
Similarity:145/266 - (54%) Gaps:42/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 KYVHR--QHW-------------------PWFILVISIIEIAIFAYDRYTMPAQNF-----GLPV 132
            |.|||  ..|                   |.||:.||:.|:|:|.|.....|.:.:     |:  
Human   123 KKVHRIVSKWMLPEKSRGTYLERANCFPPPVFIISISLAELAVFIYYAVWKPQKQWITLDTGI-- 185

  Fly   133 PIPSDSVLVYRPDRRLQVWRFFSYMFLHANWFHLGFNIVIQLFFGIPLEVMHGTARIGVIYMAGV 197
               .:|..:|.|::|.:.|||.|||.:||...|:..|:.:||..|||||::|...|:|::|:|||
Human   186 ---LESPFIYSPEKREEAWRFISYMLVHAGVQHILGNLCMQLVLGIPLEMVHKGLRVGLVYLAGV 247

  Fly   198 FAGSLGTSVVDSEVFLVGASGGVYALLAAHLANITLNYAHMKSA--STQLGSVVIFVSCDLGYAL 260
            .||||.:|:.|...:|||||||||||:..:..|:.:|:..|..|  ..:|..:::.:..|:|:||
Human   248 IAGSLASSIFDPLRYLVGASGGVYALMGGYFMNVLVNFQEMIPAFGIFRLLIIILIIVLDMGFAL 312

  Fly   261 YTQYF---DGSAFAKGPQVSYIAHLTGALAGLTIGFLVLKNFGHREYEQLIWWLALGVYCAFTVF 322
            |.::|   |||      .||:.||:.|..||::||:.|...|.....:...:|:|:..|.|..:|
Human   313 YRRFFVPEDGS------PVSFAAHIAGGFAGMSIGYTVFSCFDKALLKDPRFWIAIAAYLACVLF 371

  Fly   323 AIVFNL 328
            |:.||:
Human   372 AVFFNI 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 67/157 (43%)
RHBDL2NP_001291675.1 Rhomboid 194..346 CDD:279958 67/157 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107191
Panther 1 1.100 - - O PTHR45840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.