DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and rhbdl2

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001016521.1 Gene:rhbdl2 / 549275 XenbaseID:XB-GENE-992044 Length:290 Species:Xenopus tropicalis


Alignment Length:283 Identity:101/283 - (35%)
Similarity:155/283 - (54%) Gaps:42/283 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 TCCTRQGEHI------------YMQREAIPATPLPESEDIGLLKYVHRQHWPWFILVISIIEIAI 115
            |||.:..|.|            |::|    |..||.               |.||:.:||.|:|:
 Frog    27 TCCDKIHETISNWILPTNQRDTYLER----ANCLPP---------------PIFIISVSIAELAV 72

  Fly   116 FAYDRYTMPAQNFGLPVPIPS---DSVLVYRPDRRLQVWRFFSYMFLHANWFHLGFNIVIQLFFG 177
            |.|....||.:.:   :.:.:   :|..:||||:|.:.|||.|||.:||...|:..|:.:||..|
 Frog    73 FIYYAVWMPQKQW---ITLDTGVWNSPFIYRPDKREEAWRFISYMMVHAGVQHIIGNLALQLLLG 134

  Fly   178 IPLEVMHGTARIGVIYMAGVFAGSLGTSVVDSEVFLVGASGGVYALLAAHLANITLNYAHM--KS 240
            ||||::|...|||::|:|||..|||.:||.||.:.|||||||||||:..:..|:.:|:..|  ..
 Frog   135 IPLELVHKGHRIGLVYLAGVIGGSLASSVFDSGLALVGASGGVYALIGGYFMNVLVNFKDMIPLF 199

  Fly   241 ASTQLGSVVIFVSCDLGYALYTQYFDGSAFAKGPQVSYIAHLTGALAGLTIGFLVLKNFGHREYE 305
            ...::..::..|..|:|:|||.:|.   :...|.:||::||..|.|||::||:.|...|.....:
 Frog   200 GIFRILVIITIVGTDVGFALYRRYI---SHETGQKVSFVAHFAGGLAGMSIGYTVFSCFDKNLIK 261

  Fly   306 QLIWWLALGVYCAFTVFAIVFNL 328
            ...:|:.:..|.||.:||::||:
 Frog   262 DPRFWICIAAYAAFVIFAVLFNI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 68/154 (44%)
rhbdl2NP_001016521.1 Rhomboid 103..252 CDD:366759 65/151 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45840
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.