DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and parla

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001014320.1 Gene:parla / 541485 ZFINID:ZDB-GENE-050327-8 Length:383 Species:Danio rerio


Alignment Length:179 Identity:45/179 - (25%)
Similarity:69/179 - (38%) Gaps:65/179 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 FLHANWFHLGFNIVIQLFFGIPLEVMHGTARIGVIYMAG---------VF---AGSLGTSVVDSE 210
            |.|.:..|:..|:.:...|...:..:.|..:...:|::|         ||   .|.||.|     
Zfish   215 FSHYSVIHMVVNMYVLWTFSSSIVSLLGREQFLALYLSGGVISTFVSYVFKTATGRLGPS----- 274

  Fly   211 VFLVGASGGVYALLAAHLANITLNYAHMKSASTQLGSVVI-------------FVSCDL-GYALY 261
               :||||.:..:|||....|         ...:||.|::             .|:.|: |..|.
Zfish   275 ---LGASGSIMTVLAAVCTKI---------PEAKLGIVLLPVISFSAGNALKALVALDIAGLVLG 327

  Fly   262 TQYFDGSAFAKGPQVSYIAHLTGALAGL-TIGFLVLKNFGHREYEQLIW 309
            .::||           :.|||.|||.|: .||      :||    :|||
Zfish   328 WRFFD-----------HAAHLGGALFGVWYIG------YGH----ELIW 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 40/165 (24%)
parlaNP_001014320.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..75
Rhomboid 210..347 CDD:279958 38/159 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.