DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and rho-7

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001286324.1 Gene:rho-7 / 36281 FlyBaseID:FBgn0033672 Length:351 Species:Drosophila melanogaster


Alignment Length:243 Identity:51/243 - (20%)
Similarity:86/243 - (35%) Gaps:73/243 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 RQHWPWF---------ILVISIIEIAIFAYDRYTMPAQNFGLPVPIPSDSVLVY---RPDRRLQV 150
            |:||...         ||:.:::..|::.              ||....:::.|   .|..::..
  Fly   135 RRHWDSLTPGDKMFAPILLCNLVAFAMWR--------------VPALKSTMITYFTSNPAAKVVC 185

  Fly   151 WRFFSYMFLHANWFHLGFNIVIQLFFGIPLEVMHGTARIGVIYM-AGVFAGSLGT---SVVDSEV 211
            |..|...|.|.:..||..|:.:...|.....|..|..:...:|: ||||:..:..   :......
  Fly   186 WPMFLSTFSHYSAMHLFANMYVMHSFANAAAVSLGKEQFLAVYLSAGVFSSLMSVLYKAATSQAG 250

  Fly   212 FLVGASGGVYALLAAHLANITLNYAHMKSASTQL-------------GSVVIFVSCDL-GYALYT 262
            ..:||||.:..|||         |...:...|||             ..:.:.:..|. |..:..
  Fly   251 MSLGASGAIMTLLA---------YVCTQYPDTQLSILFLPALTFSAGAGIKVLMGIDFAGVVMGW 306

  Fly   263 QYFDGSAFAKGPQVSYIAHLTGALAGL---TIGFLV------LKNFGH 301
            ::||           :.|||.||:.|:   |.|..:      |.|:.|
  Fly   307 KFFD-----------HAAHLGGAMFGIFWATYGAQIWAKRIGLLNYYH 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 39/179 (22%)
rho-7NP_001286324.1 Rhomboid 186..327 CDD:396315 36/160 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444957
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.