DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho and rom-4

DIOPT Version :9

Sequence 1:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001076719.2 Gene:rom-4 / 3565076 WormBaseID:WBGene00004403 Length:1205 Species:Caenorhabditis elegans


Alignment Length:161 Identity:43/161 - (26%)
Similarity:67/161 - (41%) Gaps:20/161 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 DRRLQVWRFFSYMFLHANWFHLGFNIVIQLFFGIPLEVMHGTARIGVIYMAGVFAGSLGTSVVDS 209
            |...|.:|.|:.:|:||...||..:::.|.:....||.:..:.|:.::|.|....|:|.:::...
 Worm   925 DNPNQFYRLFTSLFVHAGVIHLALSLLFQYYVMKDLENLIASKRMAILYFASGIGGNLASAIFVP 989

  Fly   210 EVFLVGASGGVYALLAAHLANITLN---YAHMKSASTQLGSVVIFVSCDLGYALYTQYFDGSAFA 271
            ....||.|.....:|||.:.....|   ....|.|..|...|.:.|.| :|:.            
 Worm   990 YNPAVGPSSAQCGILAAVIVECCDNRRIIKEFKWALVQHLIVTLLVLC-IGFI------------ 1041

  Fly   272 KGPQVSYIAHLTGALAGL--TIGFLVLKNFG 300
              |.|...|||.|.:.||  ||......:||
 Worm  1042 --PWVDNWAHLFGTIFGLLTTIIIFPYLDFG 1070

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 41/156 (26%)
rom-4NP_001076719.2 Rhomboid 927..1068 CDD:366759 40/155 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.